KEGG   Nitrosococcus watsonii: Nwat_0266Help
Entry
Nwat_0266         CDS       T01266                                 

Definition
(GenBank) dihydroorotate dehydrogenase family protein
  KO
K17828  dihydroorotate dehydrogenase (NAD+) catalytic subunit [EC:1.3.1.14]
Organism
nwa  Nitrosococcus watsonii
Pathway
nwa00240  Pyrimidine metabolism
nwa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nwa00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Nwat_0266
Enzymes [BR:nwa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.14  dihydroorotate dehydrogenase (NAD+)
     Nwat_0266
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHO_dh Dus FMN_dh PcrB NMO IMPDH His_biosynth
Motif
Other DBs
NCBI-ProteinID: ADJ27236
JGI: Nwat_0266
UniProt: D8K9E7
Position
276315..277310
Genome map
AA seq 331 aa AA seqDB search
MAETFNTDLSDTDRARLKVDFCGLALQSPLVLLSGCVGFGEEYTRVVGFSNREVGAVCLK
GTTAAPRLGNAPHRIYETPMGMLNAIGLQNPGMDYVVDHILPTLDFSETYYIANVSGSTI
EEYVAVTRRFDDSPIDAIEINISCPNVKEGGVAFGNDPDMSARVVEVCRKVTRKPLITKL
SPNQTSIEENARRCIEAGTDAFAVINTLMGMAIDIEQRTPLLGNIQGGLSGPAIKPIALL
KVRQVYQVCREHGIPIIGQGGVASGKDALEFLIAGATTVGVGTALFYDPLLCAKINTEIV
AYLKRHDLATVAQLTGSLRLNEEVSGCAVSG
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atggctgagacattcaatactgacttaagcgataccgatagggcaaggctaaaggttgat
ttctgtgggctggcgttgcaaagtcccttagtgttgctttcaggttgcgtcggttttggg
gaagaatatacgcgggtagtaggtttctccaaccgggaggtgggcgcggtatgtcttaag
ggaaccacggcagctccccgtttgggaaatgccccccatcgtatttatgagacgcccatg
ggcatgcttaatgccattggcttgcaaaatcccggcatggattatgtggtcgatcatatt
ttgccgacgcttgattttagcgaaacttattatatcgccaacgtttctggctccactatt
gaagagtatgtggcggtcacccgccgctttgatgattcccccattgatgccatagaaatc
aatatttcctgtcctaatgtaaaagaagggggtgttgcttttggcaatgatcccgatatg
tcggcgcgggtggtagaagtttgtcggaaagtgactcgtaaacccctgatcaccaagctt
tcccctaaccaaacctcgatagaggaaaatgcccgtcgctgtatcgaagcgggaacggat
gcatttgccgtcatcaatacccttatgggaatggccattgatatagagcagcgcaccccg
ctgctcgggaatatccaggggggattgtcgggacccgccataaagccaatcgccttactc
aaggtacgccaagtctatcaggtatgccgggagcatggtattccgattattgggcaggga
ggagttgcttctggcaaggatgctctggaatttctcattgcgggcgctactaccgtggga
gtaggtaccgccttgttttatgatcctttgctttgcgccaaaatcaacacggaaatcgtg
gcttaccttaagcgccatgacttagcgacagtagcgcaattaacagggagcttacgctta
aatgaagaagtttcgggttgcgccgtgagtggctaa

DBGET integrated database retrieval system