KEGG   Nitrosococcus watsonii: Nwat_0268Help
Entry
Nwat_0268         CDS       T01266                                 

Definition
(GenBank) putative transcriptional regulator, TetR family
Organism
nwa  Nitrosococcus watsonii
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(278421..279068)
Genome map
AA seq 215 aa AA seqDB search
MEKTTSAPDIILDAALELAEETSWENVRLYHIAQRTGLTLNHIRHYFREKEELVDAWLDR
ADEAMLNEANRPHFSSFSPRERLNQLFMAWLEAFSPHRSVMRQMVFNRLEPGHLHMQMAS
LLRISRTVQWAREAAQREQTFLFRALDETALTSTYLATFLCWLNDPTQNYERTRRLLDRM
LYLGEVIESRKPSFLQSRRQEPNFTATPPQKVPKE
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atggagaaaacaacgagcgcccccgatatcattcttgatgctgccttggaattagccgag
gaaacttcttgggaaaatgtgcgtttataccacattgcccaacggacaggattgacctta
aaccatattcgtcactatttcagggaaaaggaagaactggtggacgcatggctagaccgg
gccgatgaggccatgctgaatgaggcgaaccgtcctcacttctcgtccttctctcctcgg
gagcgcctcaatcaactgtttatggcatggctggaagctttctctccgcaccgctcagtg
atgcgtcaaatggtatttaaccggcttgaaccagggcacctccatatgcaaatggcaagc
ctgctgcgcatcagccgtacggtacaatgggctcgggaggccgcccagcgggagcaaact
tttctgtttcgggcgcttgatgaaacggctttgacttccacctacctggctacttttctc
tgctggctcaatgatcccacccaaaattatgaaagaacccgccgattactcgatagaatg
ctgtatctaggtgaagtcatagagtcccgcaagccctcgttcctgcagtcccgccggcaa
gaaccaaatttcacagcaactccaccccaaaaggtacctaaagaataa

DBGET integrated database retrieval system