KEGG   Nitrosococcus watsonii: Nwat_0269Help
Entry
Nwat_0269         CDS       T01266                                 

Definition
(GenBank) conserved hypothetical protein
Organism
nwa  Nitrosococcus watsonii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OMP_b-brl OmpA_membrane OprF OmpW
Motif
Other DBs
NCBI-ProteinID: ADJ27239
JGI: Nwat_0269
UniProt: D8K9F0
Position
279174..280442
Genome map
AA seq 422 aa AA seqDB search
MHKQRESIVDSKRNLLFVKILLFMLVSLNVQANGLADIRPYLQPRFGFENSFYNYTKPDT
VSDVRLESPSEEPHIGATLGADLGRYWGIELAYDYIKTNLLQTSGKKAGDYAATTWLGQL
RFRYPLLQERLVPYLLAGGGIGIGEFSGREDFSFTGGGSDTVPLGVVGGGAEYFITDNIA
LGVEAKYYFGFHPDIWVGTKERELTLDAVGVTANMRVYLDELATGKYARLGQQRPARDKD
AMRGYLSLRGGVAFLTDRNAVPEASFDSTSGPWPSGSIGMNFNKHWGMELAGDYGRTQLR
SPTFGKITGYPIWTISVLGRFRYPLLDDKLSPYILAGPGLGFAEIGDPDQPLSVTGLGGG
QDNSIVAIFGAGVDYFVGYNIALNLEVKRAAFFNTQVKINGQSETLSPEFVSLTAGIRVF
FP
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
gtgcataaacaaagagagagtatcgtggatagtaaacgtaatctacttttcgtaaaaatc
ttgctttttatgcttgtatcactaaacgttcaggctaatgggttagctgatattcgccct
tatttacaacctcggtttgggttcgaaaactctttttataattatacgaaacccgatacg
gtctctgatgtgcgtcttgaatctccctcggaagaaccccatattggcgccaccttaggc
gctgatctagggcgctactggggcattgaacttgcctacgattatattaaaaccaacctt
ttgcagacctctggcaaaaaagcaggtgattacgctgcaacgacttggcttggccagcta
agattccgctacccgttactccaggagcgactggttccctacctactggccggtggtggt
atcggtatcggagagtttagcggccgcgaggatttttcctttacggggggcggtagcgac
acagtgcctctgggtgtggttggtggcggcgctgaatattttataacagataatattgcc
cttggagtcgaagcgaaatattatttcggctttcatcctgacatctgggttggcactaag
gagcgggaacttaccctggacgctgttggtgtcaccgcgaacatgcgtgtttatttggat
gagttagcgacaggtaagtatgctcgtcttggacagcaacgaccggctcgggacaaggat
gccatgcgaggttatcttagcttgcgaggcggggttgcgtttcttacggatagaaatgct
gttccagaggctagtttcgatagtacttctggaccgtggcccagtggctcaataggcatg
aatttcaacaagcattggggcatggagcttgccggtgattatggccgcacccagttgcga
tcacctacttttggaaaaattacgggctatcctatctggaccatctcggtcctgggacgt
tttcgttaccctttgcttgatgataaacttagcccctatatattagctggccccggcctt
ggttttgccgagataggcgatccggatcagccactttctgtcactggattaggcggtggt
caggataattccattgtggccatcttcggtgctggcgttgattactttgtcggctataat
atagcgcttaaccttgaagtcaaacgggctgcttttttcaacacccaggtcaagatcaat
ggccaatccgaaacgttatcgccagagtttgtttccctgacggcgggcatccgtgttttt
tttccttga

DBGET integrated database retrieval system