KEGG   Nitrosococcus watsonii: Nwat_0281Help
Entry
Nwat_0281         CDS       T01266                                 

Definition
(GenBank) glyceraldehyde-3-phosphate dehydrogenase, type I
  KO
K00134  
glyceraldehyde 3-phosphate dehydrogenase [EC:1.2.1.12]
Organism
nwa  Nitrosococcus watsonii
Pathway
Glycolysis / Gluconeogenesis
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:nwa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Nwat_0281
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Nwat_0281
Enzymes [BR:nwa01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.12  glyceraldehyde-3-phosphate dehydrogenase (phosphorylating)
     Nwat_0281
Membrane trafficking [BR:nwa04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    Nwat_0281
Exosome [BR:nwa04147]
 Exosomal proteins
  Proteins found in most exosomes
   Nwat_0281
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
292785..293798
Genome map
AA seq 337 aa AA seqDB search
MAIKVAINGYGRIGRNVLRALYEHNRNSEIQIVAINDLGDANTNAYLTQYDTVHGKFPGE
VSVDGDYLIVNGDKIRVLAERDPAKLPWDQLGVDVVHECTGLFTSKGKASAHLQAGAKKV
IISAPGGGDVDATIVYGVNHDSLKASHAVISNASCTTNCLAPVVKVLQDNIGVEHGLMTT
IHSYTNDQVLTDVYHTDLRRARSATQSMIPTKTGAAAAVGLVLPELNGKLDGFAIRVPTI
NVSLVDLTFVASRNTTKENVDGMMREAAEGDLQGVLAYNDKPLVSMDFNHDPSSSIYEAS
LTKVMGGNLVKVLAWYDNEWGFSNRMLDATVALMNAK
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atggcgattaaagtcgcaatcaatggttatggtcgtattggccgcaatgttttgcgggct
ttgtatgagcataaccgcaatagcgagattcagattgttgccattaacgatctaggagat
gccaataccaatgcctatttaacccagtatgataccgtacacggtaaatttccgggagag
gtttccgtcgatggcgattacctgatcgtcaatggcgacaaaattcgtgtgttggccgaa
agagacccggctaaattaccctgggatcagctaggggtggatgtagtacacgaatgtacg
gggttattcactagcaagggaaaagcctcagctcaccttcaagcaggagcgaaaaaagta
attatctcggccccggggggcggggatgttgatgccactattgtctacggcgttaatcat
gattctttaaaagcttcccatgccgtcatttccaacgcttcttgtaccaccaattgcttg
gcgcccgtggtaaaggtgctccaggataacattggagttgagcatggtttgatgaccacg
atccactcctacaccaacgatcaggtacttacggacgtttatcatacggatctccgccgg
gctcggtccgccactcagtcaatgatcccaactaaaacaggtgcagccgcagcggtcggg
ttggtgttgccggaacttaatggcaagctggatggattcgcgattcgagtgccaactatt
aacgtttccctggttgatcttacttttgtggcttcccgtaataccactaaagaaaacgtt
gacggaatgatgcgagaggcggctgagggtgacttgcagggagtgcttgcctacaatgac
aaaccacttgtctctatggacttcaatcatgatccctcgtcgtctatttatgaggctagc
ttgaccaaggtaatgggaggtaatttggtcaaggttttggcatggtatgataatgaatgg
ggcttttccaatcgcatgctggatgccactgtggcccttatgaatgccaagtaa

DBGET integrated database retrieval system