KEGG   Nitrosococcus watsonii: Nwat_0288Help
Entry
Nwat_0288         CDS       T01266                                 

Definition
(GenBank) phosphoenolpyruvate-protein phosphotransferase
  KO
K08483  phosphotransferase system, enzyme I, PtsI [EC:2.7.3.9]
Organism
nwa  Nitrosococcus watsonii
Pathway
nwa02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:nwa00001]
 Environmental Information Processing
  Membrane transport
   02060 Phosphotransferase system (PTS)
    Nwat_0288
Enzymes [BR:nwa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.3  Phosphotransferases with a nitrogenous group as acceptor
    2.7.3.9  phosphoenolpyruvate---protein phosphotransferase
     Nwat_0288
Transporters [BR:nwa02000]
 Phosphotransferase System (PTS)
  Enzyme I and HPr
   Enzyme I [TC:8.A.7]
    Nwat_0288
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEP-utilizers_C PEP-utilisers_N PEP-utilizers HpcH_HpaI Seryl_tRNA_N
Motif
Other DBs
NCBI-ProteinID: ADJ27258
JGI: Nwat_0288
UniProt: D8K9G9
Position
complement(301958..303706)
Genome map
AA seq 582 aa AA seqDB search
MTLELHGIGVSRGVAIGKVHMLSRDQPEVSEYILPSNLIESEVQRYQAALATAKVQLQSI
QEQIPNNISTDIAAFISTHLLMLEDKALATVPVELIITRHCNAEWALKLQRDALVSVFDE
MDDSYLRTRKNDVDHVVNRILRTLTNQESPYHEAPSGRLKGYILLADDLTPADIVLMQQQ
QVGGFATERGGANSHTSILARSLGIPAIVGLRSARRYIQDDELLIIDGGQGILLAGVDDS
LIKKFQQRRANQQHRLAALAAFRSQPAVTLEGQPITLEANIELPEDLPLVADSGAEGIGL
YRTEFLYMNRTTLPDEEEQLKAYARVVEAMKGGPVNIRTVDLGADKTVDGSHSNASIATN
PALGLRAIRLCLRKPGLFRPQLRAILRASAQGPVRLLLPMICTLQELTQVMALLEDCKRE
LKHQGLKYDPALPVGAMIEVPATAICAEAFARHLDFLSIGTNDLTQYTLAIDRIDDEVNY
LYSPLHPAVLHLIHHTIAAGEKTGTAVSLCGEMAGDIHYTRLLLALGLRDFSMHPASLLE
VKQVITESDQRKLKKLTQQILECCDLSEMQVLLEQINEDLPN
NT seq 1749 nt NT seq  +upstreamnt  +downstreamnt
atgacccttgaactgcatgggatcggtgtctcccgaggcgttgctatcggtaaagtccat
atgctttcccgcgatcaacccgaagtcagtgagtacatcctgccatcgaatcttatcgaa
agtgaagttcaacggtaccaagcggcactggctactgccaaggtgcagctacagtctatc
caagagcaaattccgaataatatctcgaccgatatcgctgcttttatcagcacccacctg
ctcatgctcgaagacaaagcactggctactgtacctgtggaacttataataaccaggcac
tgcaatgccgaatgggcgcttaaactacagcgtgacgctctggtcagcgtctttgatgaa
atggacgattcttatcttcgtacccgcaaaaacgatgtagatcatgtcgttaaccgcatt
ctacgcacactcactaatcaggaaagcccctaccacgaagcccctagcggccgccttaaa
ggatatattttattagccgacgacttaaccccggcggatattgtcctgatgcagcaacag
caagtaggtggttttgccactgaacgtggcggtgctaattctcataccagtattcttgct
cgtagcttgggtattcctgctatcgttggcctacgcagcgcacgccgttacatccaagat
gatgaattactcatcatcgatggcggacaaggaatcttgcttgcaggagtcgatgactcc
cttattaagaaatttcagcaaagacgggccaaccaacaacaccggttagcagctctagca
gcatttcggagtcagcctgcggttacccttgaaggacaacccattacgctggaggctaac
attgaattgccggaagatttacctctcgtggctgattctggcgccgagggaatcggcctc
taccgcactgaatttttatacatgaatcgtactactcttcccgacgaagaagaacagcta
aaagcctatgcgcgggtggtggaagccatgaagggaggaccggtaaacattcgtacggtc
gatctgggtgctgacaagacggtggatggaagccatagtaatgcctcgattgccactaac
cccgccttaggactgcgtgctattcgcctatgcttgcgaaaaccagggctatttcgcccc
caattacgggccattctccgggcctcggcacagggtcccgtgcggttgctattaccgatg
atctgcaccctccaggaactgacccaggtcatggcattattagaggactgcaaacgggaa
cttaaacaccaaggactgaaatatgaccccgccttgccagtaggcgctatgattgaagtt
cccgctacggctatttgtgccgaggctttcgcccgccacctggatttcctttccatcggt
accaatgatctcactcaatatacgcttgccattgaccgtattgatgatgaggtgaactac
ctctatagtcccttgcatccagcagtcctgcatctcatccatcacaccatcgctgccgga
gaaaaaacaggcacggcagtctccctctgcggagaaatggcgggagacattcactatact
cgactgctgttagcgttaggattgcgagattttagtatgcaccccgcctccctattggag
gtcaaacaggtgattaccgaaagcgatcaacgcaagctaaagaaattaactcagcagatt
ttagaatgctgcgatctctcggaaatgcaagtgctattagaacaaattaatgaagaccta
cccaattaa

DBGET integrated database retrieval system