KEGG   Nitrosococcus watsonii: Nwat_0291Help
Entry
Nwat_0291         CDS       T01266                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K06958  RNase adapter protein RapZ
Organism
nwa  Nitrosococcus watsonii
Brite
Messenger RNA biogenesis [BR:nwa03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   Other RNA degradation factors
    Others
     Nwat_0291
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP_bind_2 AAA_18 AAA_33 AAA_22 AAA_30 AAA_16
Motif
Other DBs
NCBI-ProteinID: ADJ27261
JGI: Nwat_0291
UniProt: D8K9H2
Position
complement(304427..305272)
Genome map
AA seq 281 aa AA seqDB search
MKLLIISGVSGSGKSIALHALEDRDYYCIDNLPIYLLPTFAKKMQQDARQLRAAVGIDAR
NLPQELQQFPQILEEIEKAGIHCHIIFLDASDATLLKRFSETRRKHPLSHIPLAEAIRCE
RALLETIAEKADLRIDTTCTTVHQLRDLISERIDDSVRPGMSLLFQSFGYKHGVPLDADF
VFDVRCLPNPHWEPHLRPLSGRDSEVIAYLKRHKTVTQMQRDLITFLQHWLQRFQNTNRS
YLTVAIGCTGGQHRSVYLAEQLKAHFHSLHARVLCRHRELS
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgaaattgcttattatcagtggtgtatcaggatcaggcaaaagtattgccctccacgcc
ttagaagatcgggattactactgcattgataacctgcctatttacctccttcccaccttt
gccaagaagatgcagcaggacgcccgccagctccgtgccgccgtcggtattgatgcccgc
aatcttcctcaggaattacagcagtttccgcagattctggaggaaatagaaaaggcggga
atccactgccatatcattttccttgatgccagtgatgcgacgcttcttaaacgctttagc
gaaactcgccgcaagcatccactgagccatattcccctagccgaggcaattcgctgcgag
cgggccttattagaaaccattgctgaaaaggccgatctcaggatcgacactacctgtacc
acagtacatcaactccgggacttaatcagtgagcggattgacgacagcgtacgtccaggg
atgtcgctactattccaatcttttggctacaaacatggggttcccctcgacgctgacttt
gtgtttgatgttcgctgtcttcccaacccccactgggaacctcatttgcgtcctttaagt
ggtcgtgactcagaagtaattgcctacctcaagcgtcataagacagtcacccaaatgcag
cgggacttgattaccttcctacaacattggctgcagcggtttcaaaacaccaatcgcagt
tacttgactgtggctatcggatgcacaggggggcagcatcgttcagtttatttagccgag
cagctcaaagcccatttccactccttgcatgctcgagtactttgccgccaccgggagtta
tcatga

DBGET integrated database retrieval system