KEGG   Nitrosococcus watsonii: Nwat_0293Help
Entry
Nwat_0293         CDS       T01266                                 

Definition
(GenBank) putative PTS IIA-like nitrogen-regulatory protein PtsN
  KO
K02806  
PTS system, nitrogen regulatory IIA component [EC:2.7.1.-]
Organism
nwa  Nitrosococcus watsonii
Pathway
Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:nwa00001]
 Environmental Information Processing
  Membrane transport
   02060 Phosphotransferase system (PTS)
    Nwat_0293
Enzymes [BR:nwa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.-  
     Nwat_0293
Transporters [BR:nwa02000]
 Phosphotransferase System (PTS)
  Enzyme II [TC:4.A]
   Nitrogen regulatory II component
    Nwat_0293
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(305886..306371)
Genome map
AA seq 161 aa AA seqDB search
MQITKLLGPDQVAAGTLASSKKRVLEQLSELLARGADNLNSTDIFDCLLARERLGSTGLG
HGIAIPHARMKGNQHTLAALICLDQGIDFDAMDQQPVDIFCALLVPEESTQIHVQLLARL
AEMFRDPELCAYLRKAKDPNVLLETLKEWEQNSTPSNVATK
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgcaaattaccaagctccttggtcccgatcaagttgctgctggcacccttgcaagcagc
aaaaagcgggttctagaacagcttagtgaactgctcgcccgaggcgcggataacctgaat
tcaacggatatctttgattgcctgcttgctagggaacgacttggcagcacaggtttagga
catggaatcgccattccccatgcccgcatgaaaggcaatcaacacacgttagcggcttta
atctgcctagaccagggaattgatttcgatgccatggatcagcagccggtggatatattc
tgcgctctgctggtacctgaagaatcaacgcaaatccacgtgcaattgctcgcccggtta
gcagaaatgtttcgtgatccggagctatgtgcctacctgcggaaagctaaagacccaaat
gttctcctggaaactctgaaagaatgggagcagaactccactccctcgaatgttgctacc
aagtga

DBGET integrated database retrieval system