KEGG   Nitrosococcus watsonii: Nwat_0299Help
Entry
Nwat_0299         CDS       T01266                                 

Definition
(GenBank) 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase, YrbI family
  KO
K03270  
3-deoxy-D-manno-octulosonate 8-phosphate phosphatase (KDO 8-P phosphatase) [EC:3.1.3.45]
Organism
nwa  Nitrosococcus watsonii
Pathway
Lipopolysaccharide biosynthesis
Metabolic pathways
Module
CMP-KDO biosynthesis
Brite
KEGG Orthology (KO) [BR:nwa00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    Nwat_0299
Enzymes [BR:nwa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.45  3-deoxy-manno-octulosonate-8-phosphatase
     Nwat_0299
Lipopolysaccharide biosynthesis proteins [BR:nwa01005]
 Unusual sugar
  Nwat_0299
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(310356..310877)
Genome map
AA seq 173 aa AA seqDB search
MREVFAKASAIKLALFDVDGVLTDGGLYLDDNGQEYKVFHSRDGHGMKMLQHTGVKIGII
TGRTSRVVEYRMENLGITLVYQGQKIKLPAYEHLLEQLNLQPHETAYVGDDVVDLAIMRR
VGLAIAVQDAHPLVKQHAHWITPHLGGKGAARDVCELIMEAQGTLKAQLEKYY
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgaggtatttgccaaagcctcggctataaaacttgctcttttcgatgtggatggc
gtactcaccgatggcggcctttatcttgacgataatggtcaggagtacaaagtttttcat
tctcgtgatggccatggcatgaaaatgctacaacatacaggcgttaaaattggaatcatt
acgggccgaacttcccgtgtagtcgaataccgcatggaaaaccttggaattactttggtg
taccaaggacaaaagattaagctccccgcctacgaacatctgcttgaacagcttaacctt
caaccccatgagactgcctatgtgggcgatgatgtcgtagatttggctattatgcggcga
gtggggcttgccatcgcggtccaagatgctcatccgctcgtcaagcaacacgctcactgg
attactccccacctcggtggcaaaggtgctgcgcgtgatgtctgcgagcttattatggag
gctcaaggaacgcttaaagcccagctggagaaatattattaa

DBGET integrated database retrieval system