KEGG   Nitrosococcus watsonii: Nwat_0300Help
Entry
Nwat_0300         CDS       T01266                                 

Definition
(GenBank) KpsF/GutQ family protein
  KO
K06041  
arabinose-5-phosphate isomerase [EC:5.3.1.13]
Organism
nwa  Nitrosococcus watsonii
Pathway
Lipopolysaccharide biosynthesis
Metabolic pathways
Module
CMP-KDO biosynthesis
Brite
KEGG Orthology (KO) [BR:nwa00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    Nwat_0300
Enzymes [BR:nwa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.13  arabinose-5-phosphate isomerase
     Nwat_0300
Lipopolysaccharide biosynthesis proteins [BR:nwa01005]
 Unusual sugar
  Nwat_0300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(310898..311890)
Genome map
AA seq 330 aa AA seqDB search
MSIAHNDDTDKRLLQLGAAVIDTEARAVAALRTRINENFAAACKYMLACEGRIVILGMGK
SGHIGGKIAATLASTGTPAFFVHPGEASHGDLGMITEKDVVLALSNSGETEEICTILPLI
KRLSVPLIALTGQPQSTLGRVADVHIDISVEKEACPLGLAPTASSTATLVMGDALAIALL
ESRGFTAEDFARSHPGGRLGRRLLLRISDIMHKGEEIPAILENVLLSAALLEMTRKGLGM
TAVVNAQNHAVGIFTDGDLRRALDQGIDVHATPITEIMTANCKTLGPNLLAAEALQIMQR
YRINALLVVDTEQRLIGALNMHDLLRAGVL
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgtctattgcccacaatgatgatacggataagcggctgcttcaactaggagccgctgtt
atcgacactgaggcccgggcggtagcagcgctacgaactcgaatcaatgaaaactttgct
gccgcctgtaaatatatgctggcctgcgaaggccgtatcgttattctaggaatgggcaaa
tcaggccatattggcggcaaaattgccgctactcttgccagtacgggtacgccagctttt
tttgtccaccctggtgaggccagccacggggatctgggcatgattaccgaaaaggatgtg
gtactagcactttcaaattccggagagaccgaagaaatctgtactattctccctcttatc
aaacgcctaagcgttccactgattgccctgactggtcaaccccagtcgactctaggaagg
gttgctgacgtccacattgatattagtgtcgaaaaagaagcctgccccctcggactggcg
ccgacggccagcagcacggcaaccctggtcatgggcgatgctctagctattgccttgttg
gaaagccgagggttcacagcggaagactttgcccgttcccacccaggtggccgcctgggg
cgacgtcttttgcttcgcattagcgatatcatgcacaaaggtgaagaaataccagccatt
ctagagaatgtactgctaagcgccgctttgctagaaatgacccgtaaagggctaggaatg
acggctgtcgtcaacgcgcaaaaccatgccgtaggaatctttaccgacggtgatttgcgc
cgcgcccttgaccaagggattgatgtccatgctaccccgattaccgaaattatgactgct
aattgcaaaaccctaggccccaatctactcgccgctgaagcattgcaaataatgcagcgt
tatcgtattaatgccctccttgtagtagacactgagcaacgcttaatcggcgctctcaat
atgcatgatttacttcgagccggtgtcttgtaa

DBGET integrated database retrieval system