KEGG   Nitrosococcus watsonii: Nwat_0306Help
Entry
Nwat_0306         CDS       T01266                                 

Definition
(GenBank) toluene tolerance family protein
  KO
K07323  
phospholipid transport system substrate-binding protein
Organism
nwa  Nitrosococcus watsonii
Pathway
ABC transporters
Module
Phospholipid transport system
Brite
KEGG Orthology (KO) [BR:nwa00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    Nwat_0306
Transporters [BR:nwa02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   Phospholipid transporter [MD:M00210]
    Nwat_0306
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
315954..316613
Genome map
AA seq 219 aa AA seqDB search
MWRNVMDKYRRRDVGLAAFLILTIFGFNSSFIQADPLPTASAQQLVEKTSERMLQTLREK
REELEAHPEQIYDLVKEILVPHFDFQRISRLVLGKYWRQASVEQQQRFVDEFQTLLVRTY
STALLKYSDEKINYLPLRGPKEAEKIPVRMEIEQARGGSPISMEVDLYEKEKSWKVYNIR
IGGVSLVTNHRTNFANEIRHGGLDQLIDKLKEKNQKTGG
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgtggagaaacgtgatggataagtatcgtcggcgggatgtgggtttagctgcatttttg
atattaacgatttttggctttaactcctctttcatccaggctgatccgctacctaccgcc
tcagcccagcaattagtggagaaaacctctgaacgcatgctccagaccttgcgggaaaaa
agggaagagctggaagctcatccggagcagatctacgatttggtcaaagaaattcttgta
cctcattttgattttcaacgtatttcccggttggtgcttggaaagtactggcggcaagcc
tcagtggagcagcagcaacgttttgtggacgagtttcaaaccttactggttcggacctat
tctacagccttgctgaaatatagtgacgagaagattaattatttgccattgagagggccg
aaagaggctgaaaagattcctgttcgcatggagattgaacaggccagggggggatcgccc
atttctatggaagtggatttgtatgaaaaagaaaaaagctggaaggtctataacataaga
attggtggcgtaagcttggtaactaaccatcggactaattttgctaatgagatacgtcat
gggggacttgatcagctcattgataagttaaaggaaaaaaatcaaaaaaccggcggctaa

DBGET integrated database retrieval system