KEGG   Nitrosococcus watsonii: Nwat_0308Help
Entry
Nwat_0308         CDS       T01266                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
nwa  Nitrosococcus watsonii
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:nwa00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:nwa00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
317006..318301
Genome map
AA seq 431 aa AA seqDB search
MDKLLINGGISLDGEIRISGAKNAALPILAATLLASEPVKICNIPHLHDITTTMELLGRM
GAQLMVDEHLNIEVDTRNLKEFYAPYDLVKTMRASILVLGPLLARYGRADVSLPGGCAIG
SRPVNLHIHGLQAMGATITVEEGYICARSQGRLRGTRLFMDRVSVTGTENLMMAATLAEG
TTFIENAAREPEVVDLAHCLNQMGARISGMGSDTLVIEGVDSLGGASHTVLPDRIETGTY
LVAGALTGGRVKLKNTNPGSLEAVLLKLEEAGAEINTGKDWIVLDMKGRRPRAVDIRTAP
YPAFPTDMQAQFTTLNIVAEGSGTITETVFENRFMHVQELQRMGAVIRLEGNTAFTNGVE
TLTGAPVMATDLRASASLVLAGLVAKGVTAVDRIYHVDRGYECIEEKLQQLGAKIRRVSS
YAPGKIYAAYG
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atggataagctcttgattaatggtggcatttctctggacggagaaatacgtatctcgggt
gctaagaatgctgccttacccatactcgcagcaacgttacttgcgagcgaacccgttaaa
atctgcaatatcccccacctgcatgatatcaccacgaccatggagctgcttggacgcatg
ggggctcagctcatggtggatgaacaccttaatattgaggtagatacccggaatctaaag
gaattttatgccccttatgatctagtcaaaacgatgcgcgcttctattctggtgttagga
ccgctattggcccgttatggaagagcagatgtatccttgcccggaggttgtgctattggt
tcccggccagtcaaccttcatatccatggtttacaggctatgggcgcaaccattaccgtg
gaagaagggtatatttgcgctcgttcccagggacggctaaggggcacacggctgtttatg
gatcgcgtgtcggtaacgggaaccgagaacttgatgatggcggccactttagctgaaggg
acgacctttatagaaaatgccgctcgtgagccggaggtagtggacttggcgcactgcctt
aaccagatgggggctagaattagtggtatgggtagcgataccttggtcattgagggagtt
gattccctgggtggcgcctctcatacggtgcttcctgatcgtatcgagacgggtacctac
ctagtggctggagccttgacgggcgggcgagtgaagcttaaaaataccaaccctggaagt
ttagaggccgtattgttgaagctagaggaagctggtgctgaaatcaatacggggaaggat
tggattgttttagatatgaaagggcgtcggccccgtgcagtggatatccgcaccgctcct
tatcctgcttttcccactgatatgcaggctcaatttactaccttgaatattgttgcagag
gggagtggtacgattaccgaaaccgtttttgaaaatcgttttatgcatgtccaggaacta
cagcggatgggagcggttattcggttggagggtaatactgctttcaccaacggggtagaa
acgctgaccggtgctcccgtgatggcaacggatctgcgtgcttcggccagcttggttttg
gcgggactagttgctaagggagtcactgcggtggatcgtatttaccacgtcgaccgcggc
tacgagtgcattgaggaaaaactgcaacaattgggagccaagattcgccgcgtttcgagc
tatgctcccggcaagatctatgctgcttatggttga

DBGET integrated database retrieval system