KEGG   Nitrosococcus watsonii: Nwat_0310Help
Entry
Nwat_0310         CDS       T01266                                 

Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
nwa  Nitrosococcus watsonii
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:nwa00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Nwat_0310
  Amino acid metabolism
   00340 Histidine metabolism
    Nwat_0310
Enzymes [BR:nwa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Nwat_0310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
318928..320229
Genome map
AA seq 433 aa AA seqDB search
MVEMARLDIVQGDFWPCLERRLAWEGVADETVVATVREILKAIRCRGDEALLEYTQRFDG
LEIARAPELEIPISRLQAALVGISREQREALQVAAERITAYHRHQKQESWSYTEPDGTLL
GQQVRPLDRVGLYVPGGKAAYPSSVLMNALPAKVAGVSELIMVVPTPKGEMNDLVLGAAA
IAGVDRVFTVGGAQAVAALAFGTESVPRVDKIVGPGNMYVATAKSMVFGQVGIDMIAGPS
EILVLCDGRTEPEWIAMDLFSQAEHDETAQAILLSPDGAFLDEVTEAIARLLPTLERHEV
IANSLRSRGILIKVEDLDQALEVINFIAPEHLELSVEDPQALASRVRHAGAIFMGRYTAE
AIGDYCAGPNHVLPTSRTARFSSPLGVYDFQKRSSLIQCSPQGSQTLGRVASVLARGEGL
TAHARSAEYRLKG
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atggttgagatggcgcgcttagacattgtccagggagatttttggccctgcctggagcgg
cgtttggcttgggaaggagttgcggatgaaacggtggtagctaccgtgagggagattctc
aaggcgatccgctgccggggggatgaggccctgctagagtatacccaacgttttgatggc
ctagaaatagcccgggctccagagcttgaaatcccaatctctcgtttacaggcggcgtta
gtaggcatttccagggagcagcgggaagcactccaggtggcggctgaacgcatcaccgcc
tatcaccgccatcaaaagcaggaatcttggagttataccgagccagatggtactttgctt
ggccagcaggtgaggcccctggatcgggtggggctttatgtgcctggtggtaaggcggct
tatccttcttccgtattgatgaatgccctcccggcaaaggtggcaggtgtttccgaactg
attatggtggtgccaacacccaagggcgagatgaacgatcttgtgctaggagcagcggct
attgcgggcgtggatcgggtgtttaccgtgggtggcgcgcaggcggttgctgccttggct
tttggtactgaaagcgtaccccgggtggataaaattgtcggtccgggtaatatgtatgtg
gccacggctaaaagtatggtttttggccaagtgggaatcgacatgattgccgggccttcc
gagatcttggtgctctgcgatgggagaacagagccggagtggattgctatggatttattc
tcccaggcggagcatgatgagacggcccaggccattttgctctcccccgacggtgctttt
ttggatgaagtcacggaggccatagcgcggttgctacctaccctagagcggcatgaggtg
attgcgaattccctgcggtctcgcggtatcctgattaaggtagaggatctggatcaagct
ttagaagttatcaactttatcgctcctgagcacttagagctttcggtggaagatccgcaa
gcgttagcttcccgggtccgtcatgccggggctatctttatgggacggtatactgctgaa
gctatcggcgattactgcgccggtcctaaccatgtgctgcccacctcacgcactgcccgc
ttcagctcgcccttgggcgtgtatgactttcagaagcgttccagcttgattcaatgctcg
cctcagggtagccaaactttggggcgcgtggcttcggtgctggcgcgcggcgaagggctg
accgcccatgcccgctcagcggaataccgtttaaaagggtaa

DBGET integrated database retrieval system