KEGG   Nitrosococcus watsonii: Nwat_0322Help
Entry
Nwat_0322         CDS       T01266                                 

Definition
(GenBank) conserved hypothetical protein
Organism
nwa  Nitrosococcus watsonii
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ADJ27292
JGI: Nwat_0322
UniProt: D8K9K3
Position
334196..335857
Genome map
AA seq 553 aa AA seqDB search
MANNEITGDVTYTPQEAPKEARRGTLRGTINISGDAASIIRNAVEDSTKVTLQRTAAAPT
EDQPLWVAIRNRTQAIGFNRYHNFIDRVLCEGEQASGQEGYGSPSVTDNRVSLASRPTIH
GVDAYSLLKLATDAFLIFECGVRISNAESFNAAAESNRLEQPVTIDSVRNQLSNFYLTGA
NQNVLPYLDRIVRQIVGLDATRQAERLPYCEAILQHRLTCPSLLELIWSYWHEEGMLVQT
LNAIALRFQNRRGQARDPLISLELDPLRPLNNLLWGFVQDEYNRLSVRRRAYEYDHHYGF
ALVGKAVSDFHPVDSRSKFLEAFHNLLYRTALFYKDDDDTTIIADAFALLNALREVHLIL
AEGAHNQFGDLPWTARREMLIMQWLLARPEIKEFLRGRYMVPYQEPWMGAVDAMKRLQGW
SDVTVTHFHELAIYGEQILLSIRYGDWIDVNDQQQARNWARYWRPEIQRYIHAYLATTGV
DLSVEMTDTRQAAERFLQPSVHLQKRLVAQRGRHALPSAMTTARVLPSEVFGYAELPAPV
HGRGRLLKHRAED
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atggctaataatgaaattacgggtgatgttacctatacgccccaagaagcgcctaaagag
gcacgcagagggacattaagaggaacaataaatattagcggggatgctgcaagcataatt
cggaatgcggtggaagactctactaaggtcaccttacagcgaaccgccgccgcgccgact
gaagatcaacccctgtgggtggcgattcgcaaccgcactcaagcgattggcttcaaccgt
tatcataattttattgatagggtcttatgcgagggagaacaggccagcggtcaggaaggc
tatggatctccttcagttacagataaccgcgtgagcctcgcatctcggccaaccatccat
ggggtagatgcctactccctactcaagttggccacggatgcttttctcatttttgagtgc
ggtgtcaggattagcaacgctgaatcattcaacgctgccgccgaaagcaaccgtttagaa
cagcctgttaccattgatagcgttcggaatcaactcagtaacttttatcttaccggcgcc
aatcaaaatgtattaccttatctggatcgtattgtcaggcagattgtcgggcttgatgca
actcggcaagcagagcgcctcccttactgcgaagccatattacagcatcggcttacctgc
cccagcctgctggagctgatttggtcctattggcatgaagaaggcatgctggtgcagact
ctaaacgccattgccttgcgtttccagaatcggcgcggtcaggcacgggaccccttgata
agtttggaattggatcccctgcgccccctgaacaatctgctgtggggttttgttcaggac
gaatataaccgactgagcgtacggcggcgcgcctatgaatatgaccaccactatggattt
gcgctggtgggcaaggccgttagcgattttcatcccgttgatagccgctccaagtttctg
gaagccttccacaacttgctttaccgcactgccctgttctacaaggacgatgacgatact
accatcattgccgatgcctttgcgctgcttaacgccctgcgggaagtgcatctcattctg
gccgaaggcgcccataaccagttcggagatctgccctggacagcccgccgggaaatgttg
attatgcagtggttgctggctcggccagaaatcaaggaattcctgcgagggcgctatatg
gtgccctatcaggagccctggatgggggcggtggatgccatgaaacggctgcaaggctgg
agcgatgtcaccgttacccatttccacgagctggcgatttatggtgaacaaatcttgctc
tccatccgctatggagactggattgatgtcaatgaccagcagcaggcgcgcaattgggcc
cgctattggcgaccggagattcagcgctacatccatgcgtatctggccacgaccggcgtg
gacctgtcggtggagatgaccgatactcggcaagcggcggagcgttttctccaaccttcg
gttcatttgcaaaagcgcctcgtggcgcaacggggcaggcatgccttgccatcggcaatg
acgaccgccagagtcctgccctccgaggtttttggctatgcggagctaccagcgccggtt
catggtcgtggtcgcttgctcaagcatagagcggaggattag

DBGET integrated database retrieval system