KEGG   Nitrosococcus watsonii: Nwat_0325Help
Entry
Nwat_0325         CDS       T01266                                 

Definition
(GenBank) amidohydrolase 2
  KO
K07045  uncharacterized protein
Organism
nwa  Nitrosococcus watsonii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidohydro_2 TatD_DNase TraY
Motif
Other DBs
NCBI-ProteinID: ADJ27295
JGI: Nwat_0325
UniProt: D8K9K6
Position
339183..339992
Genome map
AA seq 269 aa AA seqDB search
MIIDCHCHAGKGDGLTGPWDTRASLKKYLRRAAQAGIKQTVLLAAFHSDYEAANREVARI
VASRPHRFYGFAMVHSLRDRGRIYTLVKLAVERYGFVGIKVHRHDGRITREICETAQAFA
LPVLYDVMGEISVCELLAREYPNVAFIIPHLGSFADDWRAQLALIDHLARYPNIYTDTSG
ARRFDLLEEAVRRAGAEKILFGSDGPWLHPGLELAKVRALSLPLPKEQWVLGGNFLRLIA
RVRAEPRGAPLVSTHPPLLQAEGLSDPWL
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgatcatcgactgccattgccacgccggtaaaggcgatggtctaactggcccttgggat
acccgggcttcgctgaaaaaatatctgcgccgggcggcccaagcgggcattaagcaaaca
gtgcttttagccgcttttcactcggattatgaggcggccaaccgggaagtggcccgaatc
gtggctagccgtccgcatcgcttttatggctttgccatggtccattccctgcgggatcgt
gggcgcatttacactttagtcaagttggccgtcgagcgctatggctttgtgggcattaag
gtgcaccgtcatgacgggcggattacccgtgagatctgtgaaacggcgcaagcgtttgcc
ctcccggtgctctatgacgtgatgggtgagatttcggtatgcgaactgcttgcccgagaa
tatcccaatgtcgcgtttattatcccccacctgggcagctttgccgatgattggcgggcc
cagctcgccctgattgaccacctggcgcgttaccccaatatctatactgatacctccggg
gcacgccggtttgatctcctggaagaagcggtacggcgagccggagcggagaaaattctg
tttggctccgacggtccgtggttgcatcctgggcttgaattggccaaagttcgcgctttg
agtttgccgttgcccaaggagcaatgggtgctaggtggtaattttttgcgtctcatcgct
cgcgtgcgagcagagccaaggggagcccctcttgtctcgactcatccgccgttgctccaa
gcggaaggattatccgatccctggctatag

DBGET integrated database retrieval system