KEGG   Nitrosococcus watsonii: Nwat_0328Help
Entry
Nwat_0328         CDS       T01266                                 

Definition
(GenBank) Kelch repeat-containing protein
Organism
nwa  Nitrosococcus watsonii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Kelch_6 Kelch_1 Kelch_2 Kelch_3 Kelch_4 Kelch_5
Motif
Other DBs
NCBI-ProteinID: ADJ27298
JGI: Nwat_0328
UniProt: D8K9K9
Position
complement(342414..343400)
Genome map
AA seq 328 aa AA seqDB search
MRFNKIHLSSLLLLSLSFLAYSASEQWQQLHPMPTHRSEMAAAYLDGKIYAPGGLGGQRQ
FEVYDATTDSWEQLAPLPAPRHHLMATAHQGKIYVFGGGDPDWSPMATAWVYDPPNNRWR
TLTPLPEPRYAGGAVSMGDFIYVVGGKGPSGRLLRYDPQRDVWTFLKAMKQRREHIRSVV
FKDKIAAIGGRYQGVGELRSVEIYDPATDTWQEGPPLNTARGGHGAAVHQGKIYVFGGEV
IMTGRTTLSNSEILGNLSGKWQPGPPLPMALHGMPAISTGSHLYILGGSEQAAASINRGR
VYRLLETPGPPPALSFGSFLTILDKTTS
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgagatttaataaaattcacctaagctcacttctcttgctgagcctatcatttctagcc
tattccgcctcagagcaatggcaacaactacatcccatgcccacccaccgttcggaaatg
gcagcagcctatctggatggtaaaatatatgcaccaggaggcttaggtggtcagcgccag
tttgaagtatatgatgctaccactgatagctgggagcaactggcgccactgccagcccct
cgccatcacctcatggccacagcccatcaggggaaaatctatgtttttgggggcggcgat
ccagactggtccccaatggcaactgcttgggtctacgatccccccaacaatcgttggcga
actttaacccccctgcctgaacctcgttacgcgggaggtgccgtctcaatgggggatttt
atctatgtcgtaggcggcaaaggccccagcggaagattactccgctatgacccccaacga
gacgtctggactttcctaaaggcgatgaagcagcgccgggagcatatccgcagcgtggtt
ttcaaagataagatcgccgccattggcggccgttatcagggtgtcggtgaactacgctca
gtggaaatttatgatcccgcaaccgatacttggcaagaaggcccccccttgaataccgcc
cggggcggacatggcgcagcggttcatcaagggaaaatctatgtttttggcggcgaggtc
atcatgactggacgaacaaccttgagcaactcggaaatcttgggaaatctatccggaaaa
tggcaacccggtcctcccttgcccatggcgctccacgggatgcccgctatcagcaccggc
tctcatttgtatattctggggggctcagaacaggcggctgccagcatcaaccggggccgg
gtctatcgcctgctagaaacgccaggcccaccacctgcccttagcttcggctcattcctt
acgatcctagataaaaccacgtcttga

DBGET integrated database retrieval system