KEGG   Nitrosococcus watsonii: Nwat_0331Help
Entry
Nwat_0331         CDS       T01266                                 

Definition
(GenBank) prolipoprotein diacylglyceryl transferase
  KO
K13292  
phosphatidylglycerol:prolipoprotein diacylglycerol transferase [EC:2.-.-.-]
Organism
nwa  Nitrosococcus watsonii
Brite
Enzymes [BR:nwa01000]
 2. Transferases
  2.-  
   2.-.-  
    2.-.-.-  
     Nwat_0331
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
346286..347092
Genome map
AA seq 268 aa AA seqDB search
MSYPNIDPVAFSLGPLKVHWYGIMYLIGFLGAWWLGRFRAKRPASGWRPEQVDDLIFYGA
LGVILGGRLGYALFYDFDHILADPFAIFKIWQGGMSFHGGLLGVLVAMAVYARKAGKGFF
QVTDFVAPLVPIGLGAGRIGNFINGELWGKVTELPWGMVFPDPRAGGLPRHPSQLYEAAL
EGVALFLILWFFSRRPRPTMAVSGLFLFCYGLFRFAVEFVRVPDAHLGYLALDWLTMGQI
LSLPMVFIGMILLGWAYRKRSSTHSIKS
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgagttatccaaatattgacccagtcgccttttccttgggtccgctcaaggtccattgg
tatggcatcatgtatttaattggctttttgggtgcctggtggctaggtcgttttcgagcc
aagcgtcctgcttccggttggcgaccggagcaggtggatgatctgattttctatggtgcc
ctgggggttattcttggtggccggctgggatatgctctgttctacgattttgatcatatc
ctggcggatccttttgctatctttaaaatttggcaaggagggatgtctttccacgggggg
ctgctcggcgttctggtcgccatggcggtctatgcccgtaaagcgggcaaagggttcttt
caggtgacggattttgtcgcccccctggttcctattgggttaggcgcgggccgcattggc
aatttcatcaatggggagttgtggggtaaggtgacggaattgccctggggcatggtgttc
cctgatcccagggctggcggtctgccccggcacccctcgcaactgtacgaggcagctctg
gaaggagtggccctttttcttattttgtggtttttctcccgccggccccgccccaccatg
gcggtctcgggcctgtttctattttgctacgggctgtttcgctttgcggtggagtttgtg
cgcgtgccggatgcccatctgggttatttggccctggattggctgaccatgggacaaatc
ctaagtctgcccatggtttttatcggcatgattttactgggatgggcttatcggaagcgt
tcttctacccattcgataaaatcttag

DBGET integrated database retrieval system