KEGG   Nitrosococcus watsonii: Nwat_0332Help
Entry
Nwat_0332         CDS       T01266                                 

Definition
(GenBank) thymidylate synthase
  KO
K00560  
thymidylate synthase [EC:2.1.1.45]
Organism
nwa  Nitrosococcus watsonii
Pathway
Pyrimidine metabolism
One carbon pool by folate
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nwa00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Nwat_0332
  Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    Nwat_0332
Enzymes [BR:nwa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.45  thymidylate synthase
     Nwat_0332
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
347117..347911
Genome map
AA seq 264 aa AA seqDB search
MKPYLDLIQKILATGVEQDDRTGTGTWSIFGHQMRFDLRQGFPLVTTRKLHVRSIFIELL
WFLRGETNVKYLHDHGVTIWDEWADEQGELGPIYGYQWRSWPLPDGGYLDQMAKVSTQIR
HYPHSRRHIVVAYNPACVDEMALPPCHALFQFYVAQGRLSCQLYQRSADVFLGTPFNIAS
YALLTHLMAQQCGLGVGEFIWTGGDVHLYRNHLEAARLQLTREPLPLPRLQIKRRPSSLF
EYQYDDLEIVDYQSYPAIKAAVSV
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccgtacctggatcttatccaaaagatacttgctaccggcgttgagcaagatgat
cggactggcaccggaacgtggtctattttcgggcatcagatgcggtttgacctgcgacag
ggttttccgctggttacgaccagaaagcttcatgttcgctctatttttattgagttacta
tggtttctccggggtgagaccaatgtgaaatatctccatgatcatggagtgacaatttgg
gatgaatgggccgatgaacagggggagctagggcctatctacggttatcaatggcgctcg
tggcctctgcctgatgggggatatttagaccagatggcgaaagtgtcaacacagatacgg
cattatccccatagccgacgccatatcgtggtggcttataatccggcttgcgtggatgaa
atggcgctgcctccctgccatgcgttgtttcaattttatgtagcccagggtcgtttgtct
tgccaactttatcagcgcagtgccgatgttttccttggaactcctttcaacattgcctcc
tatgccttgttgactcatctgatggctcaacaatgcggtttaggggtgggggaattcatt
tggacgggaggggatgttcatctgtaccggaatcacctggaagcagcgcgtttgcagctc
actcgggaaccgcttccgcttcctcggctccaaatcaagcgtcgaccttcttctttgttt
gaatatcaatacgatgatctggagattgtggattatcaaagctatcccgctataaaggcg
gccgtttcagtataa

DBGET integrated database retrieval system