KEGG   Nitrosococcus watsonii: Nwat_0333Help
Entry
Nwat_0333         CDS       T01266                                 

Definition
dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
nwa  Nitrosococcus watsonii
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nwa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Nwat_0333
   00670 One carbon pool by folate
    Nwat_0333
Enzymes [BR:nwa01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     Nwat_0333
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
347921..348418
Genome map
AA seq 165 aa AA seqDB search
MVIAFIVAMDEHRLIGANRRLPWHLPADLKYFRRMTMGRPMLMGRSTHEAIGRPLPRRHN
IVVTHNSGYKAPGCTVVHTVEAGLQAAGEAEEIMVIGGASLYQQLLPQAQRIYLTLVGGH
FQGDTWFPVFDSGAWVEVWREDHNPDPQNPYPYSFIRLERKKDKN
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atggttattgccttcattgtcgccatggacgagcatcgtttgattggggctaatcgtcgt
ctgccttggcatttaccggcggatctcaaatattttcgccgcatgaccatgggtagacca
atgctcatggggcggagcactcacgaagccattggacgtcccctgccccggcgacataat
attgtcgtgacccataactctggctataaagcgccgggatgcaccgtggtccatactgtg
gaagcgggcttgcaggcagcgggggaagccgaggagataatggtgattggtggggcttcc
ctttatcagcaattattaccccaggcgcaacgcatctacctcacactggtgggagggcat
ttccaaggtgatacctggtttccagtctttgattctggcgcctgggttgaggtttggcgg
gaggatcataatcccgatcctcaaaatccctatccttatagttttattcgtcttgagcgg
aagaaggataaaaattaa

DBGET integrated database retrieval system