KEGG   Nitrosococcus watsonii: Nwat_0334Help
Entry
Nwat_0334         CDS       T01266                                 

Definition
(GenBank) DNA repair protein RadC
  KO
K03630  
DNA repair protein RadC
Organism
nwa  Nitrosococcus watsonii
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(348436..349110)
Genome map
AA seq 224 aa AA seqDB search
MAITDWPIHERPREKLLQRGPNALSDAELLAIFLRTGVAGKTAVDLARELLESFGSLRAL
LEADLKQFCHAPGLGIAKYTQLQACLEMGRRHLEATLKRGDVLTDPQTTQRYLMARLRAY
PFEVFSCLFLDNQHRVLAFEELFRGTIDGASVHPREVLKRALAHNAAAAILAHNHPSGIA
EPSRADECITQRLKEALALVDIRVLDHIIVGDGETFSFAERGLI
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atggcaattaccgactggcccatccacgaaaggccccgcgagaaactccttcaacgaggc
ccaaatgccttatccgatgccgaacttttagctatttttctccgcaccggggtcgccggg
aaaaccgccgttgacttggcacgggagctcctggaaagctttggtagcctccgagcattg
cttgaggctgaccttaaacagttctgccatgctccagggctgggaatagccaagtatacg
caactgcaagcctgcctggaaatgggacgccgccacctggaagccacgctcaagcggggc
gacgttctgaccgatcctcaaactacccaacgctacctcatggcacgcttgcgagcttat
ccttttgaagtcttctcttgtctttttcttgacaaccagcaccgagtactagccttcgaa
gagcttttccgaggcactattgatggcgctagtgtacatcctcgcgaagtgctcaagcgc
gcccttgcccataacgccgcagctgccattctagctcacaatcatccctccgggatagcc
gaacccagtcgagccgatgagtgcatcacacaacgtcttaaggaagcgttggcgttggtg
gatattcgggttctcgatcatattattgtgggagatggcgaaaccttttcctttgccgag
cgggggctcatctaa

DBGET integrated database retrieval system