KEGG   Nitrosococcus watsonii: Nwat_0341Help
Entry
Nwat_0341         CDS       T01266                                 

Definition
(GenBank) ribosomal protein L31
  KO
K02909  large subunit ribosomal protein L31
Organism
nwa  Nitrosococcus watsonii
Pathway
nwa03010  Ribosome
Module
nwa_M00178  Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:nwa00001]
 Genetic Information Processing
  Translation
   03010 Ribosome
    Nwat_0341
Ribosome [BR:nwa03011]
 Ribosomal Proteins
  Bacteria
   Large subunit
    Nwat_0341
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L31
Motif
Other DBs
NCBI-ProteinID: ADJ27311
JGI: Nwat_0341
UniProt: D8K9M2
Position
356507..356713
Genome map
AA seq 68 aa AA seqDB search
MRQDIHPKYSEITVTCSCGNSFSTRSTAGKDFHIEVCSACHPFYTGKQKLLDTAGRVDKF
RQRYNLKS
NT seq 207 nt NT seq  +upstreamnt  +downstreamnt
atgaggcaggatattcatcccaagtacagcgaaattacggtgacttgtagctgcggtaat
agttttagtacccgctcgactgcaggtaaggattttcatatagaagtttgttctgcttgc
caccccttctatactggtaagcagaagctattggacactgcgggtcgggtagataaattc
cgccagaggtacaatttaaaatcttag

DBGET integrated database retrieval system