KEGG   Nitrosococcus watsonii: Nwat_0343Help
Entry
Nwat_0343         CDS       T01266                                 

Definition
(GenBank) conserved hypothetical protein
Organism
nwa  Nitrosococcus watsonii
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(358175..358789)
Genome map
AA seq 204 aa AA seqDB search
MPKKDQQMREYIATEAARFMVEHGIKNYYQAKRKAATFLGAADTKNLPTNQEIEQAVGAY
LRLFKSQSQPATVERLRQTALEAMDFFSRFNPHLVGSVLSGLAFEYSDINLHLFADTEEE
VALFLTEAGIPFQLKSKQLSFSSKLFQNFPVYRFIAGEVAVELTVFPPAATRHAPLSPID
GKPMRRAGRKKVQSLLKAKTQAAD
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgcctaaaaaagatcagcaaatgagggaatatatcgctacagaggcggctcggtttatg
gtcgaacatggaattaaaaattactaccaagctaaacgcaaggcagccacctttttaggt
gctgcagataccaaaaatttgcctactaaccaagaaatagagcaagcagtgggtgcctat
ttacgcttattcaaatcacaatcccaacctgctaccgtggaaaggttacgtcaaacagca
ttagaagcaatggattttttttcccgctttaatccacacctcgttggctcagtgctcagc
ggactggcttttgaatactccgacattaacctccatctcttcgccgatactgaggaagaa
gttgcattatttctcacggaagcaggaattcccttccaattaaaatctaagcaactgtcc
ttttcctctaaactatttcaaaatttcccggtttatcgtttcatagcgggagaagttgcc
gtagaactaactgtatttcctccggcagctactcgccacgctccgctcagccctatagat
ggaaaacccatgcgccgggcagggcgcaagaaagtacaatctttactgaaggcaaagacc
caagctgcggattaa

DBGET integrated database retrieval system