KEGG   Nitrosococcus watsonii: Nwat_0371Help
Entry
Nwat_0371         CDS       T01266                                 

Definition
nicotinamidase (EC:3.5.1.19)
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
nwa  Nitrosococcus watsonii
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nwa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    Nwat_0371
Enzymes [BR:nwa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     Nwat_0371
    3.5.1.-  
     Nwat_0371
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
391134..391799
Genome map
AA seq 221 aa AA seqDB search
MERPAVTFNRARAVLLLVDIQPDFLPGGGLPVADGDQIIEPVRFLMESDKFCHYVATQDW
HPPGHISFASSHPGAEPMATLEVNGYAQTLWPDHCIQGTSGAELHGDLPWEKVAAIIRKG
TDPESDSYSGFHNNWNSAGERPATGLAGYLRERGVEELFICGLARDVCIKWTAEDGANAG
FNVYVLWDLTRPVEPSSDDQVRQELIAHDVKIVGLEQLVKC
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atggaaagacctgctgttacctttaatagggcacgcgccgtattattattggtagatatt
caaccggattttctgcctggaggcggacttccggtagcagatggcgaccaaattattgag
ccagtgcgtttcctgatggaatccgataaattttgtcattacgtggcgactcaggattgg
catccacctggtcatatctcctttgctagcagccatccaggggctgaacctatggctacc
cttgaagtcaacggttacgcccagaccctatggcccgatcactgtatccagggaacctca
ggcgctgaacttcatggagacctaccctgggaaaaggtggcggccattatacgtaaggga
actgatccagagagcgattcttatagcggatttcataataactggaattccgcgggcgag
cgtcctgctaccggattagcgggttatttgcgggagcggggcgtggaagaattatttatc
tgcggccttgcccgcgatgtttgcataaaatggaccgctgaagatggcgcgaatgccggt
tttaatgtttacgtgctatgggatcttacccgccccgtggaaccttcttccgatgatcag
gtacgccaggagcttatagcccatgatgttaagattgttggtttggaacaacttgttaaa
tgttga

  All links  
No link information was found.   
DBGET integrated database retrieval system