KEGG   Nitrosococcus watsonii: Nwat_0389Help
Entry
Nwat_0389         CDS       T01266                                 

Definition
DNA polymerase III subunit HolC
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
nwa  Nitrosococcus watsonii
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:nwa00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:nwa00240]
Genetic Information Processing; Replication and repair; DNA replication [PATH:nwa03030]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:nwa03430]
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:nwa03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(406774..407205)
Genome map
AA seq 143 aa AA seqDB search
MTKVDFYLLTSHQPQASKRFACKLTEKAYRLGHQIYIQTENQAQAQEMDELLWTFRQGSF
VPHALINSEEADESPVLIGYEREPEGKLELLINLCAEVPAFFSRFQRVAEIIGQDENHRH
AGRQRYRYYRDHGCLLETHELNF
NT seq 432 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaggtcgatttctacctgttgaccagccaccagccacaagccagcaaacggttt
gcctgcaagttaaccgagaaagcctaccggcttggccatcagatttatatccagacggaa
aaccaagcccaggcccaggaaatggatgagctcttatggaccttccgtcagggtagcttt
gtgccccatgccctgattaatagcgaggaagcggatgaatcccctgtactcattggttat
gagagagaaccggaaggaaagctggaactcttgattaatctttgcgcggaagtacctgct
tttttttcccgtttccaaagagtagcagaaattatcggccaggatgagaatcatcgccat
gctggccgtcaacgttatcgttattatcgggatcatggctgcttactagaaacgcatgag
ttaaatttttaa

DBGET integrated database retrieval system