KEGG   Nitrosococcus watsonii: Nwat_0501Help
Entry
Nwat_0501         CDS       T01266                                 

Definition
Protein-l-isoaspartate(D-aspartate) O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
nwa  Nitrosococcus watsonii
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
517727..518365
Genome map
AA seq 212 aa AA seqDB search
MNLEQARVNMVEQQIRPWEVLDQRVLDRLAAVLREDFVPPAFRNLAYADVQIPLGQGQVM
LPPIIEGRLLQALDLKESESVLEIGTGTGYLTTVMAGLAGHVTSVDIFPELRRFSEQPLA
NISLEVGDAARGWSKGGPFDAIAITGALPDLPRAFLETLKLGGRLFAVLGRAPVMEAVLI
TRVGEQEWSREGLFETVIPPLLNSEPKPKFVF
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgaacctggagcaagctcgcgttaatatggtggaacagcagatccgcccctgggaagta
ctcgatcagcgggtattggatcggcttgccgccgtgcttcgggaagattttgttccgcca
gcatttagaaacctggcttacgcggatgttcaaatacctcttgggcaaggacaagtgatg
ttgccccccatcatcgagggccgtttactccaagctttggatcttaaggagtcagaatcc
gttttggagataggaaccgggactggttatctaacaacagttatggccggtttggctggc
catgttactagtgtcgatatttttcctgaattacggcgcttttctgaacagccactagcc
aatatttctctggaggtaggagatgcagcccgtggctggtctaagggagggcctttcgat
gccattgcgatcacgggcgctcttcctgatttgcctcgtgcttttctggaaacactcaaa
ctgggtggacgtttgtttgcggttctaggccgggcgccggtgatggaggcagtgctcatt
acccgcgtaggtgagcaagagtggtcccgggaagggttgtttgagacggttataccaccc
ttgcttaatagcgagcccaagccaaaattcgtgttttaa

DBGET integrated database retrieval system