KEGG   Nitrosococcus watsonii: Nwat_0501Help
Entry
Nwat_0501         CDS       T01266                                 

Definition
(GenBank) Protein-L-isoaspartate(D-aspartate) O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
nwa  Nitrosococcus watsonii
Brite
Enzymes [BR:nwa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Nwat_0501
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT Methyltransf_25 Methyltransf_31 RrnaAD Methyltransf_23 Methyltransf_11 MTS Methyltransf_32 Methyltransf_12 CMAS NodS Methyltransf_3
Motif
Other DBs
NCBI-ProteinID: ADJ27466
JGI: Nwat_0501
UniProt: D8KAF1
Position
517727..518365
Genome map
AA seq 212 aa AA seqDB search
MNLEQARVNMVEQQIRPWEVLDQRVLDRLAAVLREDFVPPAFRNLAYADVQIPLGQGQVM
LPPIIEGRLLQALDLKESESVLEIGTGTGYLTTVMAGLAGHVTSVDIFPELRRFSEQPLA
NISLEVGDAARGWSKGGPFDAIAITGALPDLPRAFLETLKLGGRLFAVLGRAPVMEAVLI
TRVGEQEWSREGLFETVIPPLLNSEPKPKFVF
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgaacctggagcaagctcgcgttaatatggtggaacagcagatccgcccctgggaagta
ctcgatcagcgggtattggatcggcttgccgccgtgcttcgggaagattttgttccgcca
gcatttagaaacctggcttacgcggatgttcaaatacctcttgggcaaggacaagtgatg
ttgccccccatcatcgagggccgtttactccaagctttggatcttaaggagtcagaatcc
gttttggagataggaaccgggactggttatctaacaacagttatggccggtttggctggc
catgttactagtgtcgatatttttcctgaattacggcgcttttctgaacagccactagcc
aatatttctctggaggtaggagatgcagcccgtggctggtctaagggagggcctttcgat
gccattgcgatcacgggcgctcttcctgatttgcctcgtgcttttctggaaacactcaaa
ctgggtggacgtttgtttgcggttctaggccgggcgccggtgatggaggcagtgctcatt
acccgcgtaggtgagcaagagtggtcccgggaagggttgtttgagacggttataccaccc
ttgcttaatagcgagcccaagccaaaattcgtgttttaa

DBGET integrated database retrieval system