KEGG   Nitrosococcus watsonii: Nwat_0523Help
Entry
Nwat_0523         CDS       T01266                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
nwa  Nitrosococcus watsonii
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:nwa00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Nwat_0523
DNA repair and recombination proteins [BR:nwa03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Nwat_0523
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(540938..541537)
Genome map
AA seq 199 aa AA seqDB search
MSLFGLSLGRLIEALCCLPGVGPKSAQRMAFYLLESNREGGQRLAQALLEALDKMTHCQT
CRILSETDLCSLCADSRRDHGQLCVVEMPSDVQAIEQATNYAGRYFVLMGHLSPLDGVGP
EALGMDLLAKRLDTDQIREVILATNLTVEGEATAYYISELAQTRGITTTRIAHGVPLGGE
LEFIDSNTLSHAFQSRQHL
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
gtgagtttattcggcctttctctaggacgcctcattgaggccctgtgctgcctccctggc
gttggccctaaatctgcgcagcgcatggccttttacctcttggaatctaatcgggaaggg
gggcaacgccttgcccaagcattgctggaggcgctggataagatgacgcactgccaaact
tgccgcatcctcagtgaaaccgatctatgttccctctgtgccgattccaggcgggatcac
ggacagctctgtgttgtggaaatgcccagtgatgtccaagccattgagcaagcaacaaac
tatgctggtaggtacttcgttctaatggggcacttatctccccttgatggcgtgggtccc
gaagcattgggtatggacttactggcaaaacgactggatacagatcaaattcgcgaagtt
atccttgccactaatctaaccgttgaaggtgaagcaaccgcctattacatcagtgaattg
gcgcaaactcgcgggatcactaccacccgtattgcccatggagttcctctaggcggcgag
cttgaattcattgatagtaacaccctatcccacgccttccaaagccgccagcatctttaa

DBGET integrated database retrieval system