KEGG   Nitrosococcus watsonii: Nwat_0545Help
Entry
Nwat_0545         CDS       T01266                                 

Definition
porphobilinogen synthase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
nwa  Nitrosococcus watsonii
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nwa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Nwat_0545
Enzymes [BR:nwa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Nwat_0545
Exosome [BR:nwa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Nwat_0545
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(563375..564460)
Genome map
AA seq 361 aa AA seqDB search
MTVAVSYGMIDFTCGSNGGIVNLSAHLWNSRSFPRTRPRRMRRDDFSRRLMQENHISCHD
LIYPVFILDGQGHRETISSMPGIERVTIDGLLDEAKELITLGIPAIALFPVTPPTQKSDD
ACEAYNPDGLAQRAVRALKQHFPKLGVITDVALDPFTSHGQDGLIDAHGYVKNDETVEVL
VRQALSHAEAGADIVAPSDMMDGRIGAIRQALESAGHTNTRILAYSAKYASSFYGPFRDA
VGSADNLGGGNKYSYQMDPANSDEALQEVSLDLEEGADMVMVKPGMPYLDIVQRVKTIFG
VPTFMYQVSGEYAMLTAAAQNGWLDRQAVVMESLLAMKRAGADAILTYFAKDAARWLKNE
Q
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgacagtggcggtttcctatgggatgattgattttacatgtggctctaatggaggaatt
gtaaacttgtcggcgcacctttggaatagcagatctttccctcgcactcgtccccgtcgg
atgcggcgtgatgatttctcccgacgactgatgcaggaaaatcatataagctgccatgat
cttatttatccggtatttattcttgatggccaaggccaccgcgagacgatctcctccatg
ccgggtattgagcgggtcactatcgatggtctactagatgaggctaaagaacttattacc
cttggcatccccgccattgccctatttccagtaacgccgcctacccaaaaatcggacgac
gcctgtgaagcctataatccagatggcctcgcacaacgggcggtacgggctctaaaacag
cattttcctaaattaggcgtgatcactgacgttgccctagatccttttaccagccacggc
caggacggtctaatagatgcccatggttatgtaaagaacgatgaaaccgtcgaggtgtta
gtaaggcaggccctttcccatgcagaagctggcgccgatattgtcgccccctccgatatg
atggatggtcgtatcggtgctattcgccaggccctagaaagcgccggtcacactaatact
cggattcttgcctattcagcaaaatatgcttctagtttttacggacctttccgggatgcg
gtcggttcggcggataaccttggcggcggcaacaagtacagctaccaaatggacccagcc
aatagtgatgaagcactgcaagaggtgtctttagatttagaagaaggcgcggatatggtc
atggtcaagccgggaatgccctatctggatattgtccagcgcgttaagaccatctttggg
gttcccaccttcatgtatcaggtcagtggcgagtatgccatgctaaccgccgccgctcag
aacggctggctagatcggcaagcagttgtgatggaatctctgcttgccatgaagcgagct
ggggccgatgccatcttgacctactttgctaaagacgcggcccgctggctaaaaaacgag
cagtag

DBGET integrated database retrieval system