KEGG   Nitrosococcus watsonii: Nwat_0554Help
Entry
Nwat_0554         CDS       T01266                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
nwa  Nitrosococcus watsonii
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:nwa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Nwat_0554
   01230 Biosynthesis of amino acids
    Nwat_0554
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Nwat_0554
   00051 Fructose and mannose metabolism
    Nwat_0554
   00562 Inositol phosphate metabolism
    Nwat_0554
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Nwat_0554
Enzymes [BR:nwa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Nwat_0554
Exosome [BR:nwa04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Nwat_0554
  Exosomal proteins of bladder cancer cells
   Nwat_0554
  Exosomal proteins of melanoma cells
   Nwat_0554
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
574916..575668
Genome map
AA seq 250 aa AA seqDB search
MRTSLVVGNWKMNGSRAANRALLESMRKEMEAGVVAEVAVCPPFVYLADMESLLQGSVIN
WGAQNLSHHEMGAYTGEIAPSMLADLGCRFVIIGHSERRTLYGETDSLVAEKAIAAQKVD
IIPIICVGETLQEREQNITEQVVERQLNAVLQLAGVNALKKAVIAYEPIWAIGTGRTATP
EQAQEVHAFIRGHVAVQNSGIAEELLVLYGGSVKGSNAAQLLAMPDIDGGLIGGASLNAK
EFLTICQAAV
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
gtgcgtacatccctagtcgttggtaactggaagatgaatggctcgcgggccgctaaccgc
gctttgttagaatctatgcgcaaggaaatggaagctggagtagttgcggaggtggcggtt
tgcccaccttttgtataccttgctgacatggaatccttgttacaaggatcggttattaat
tggggcgctcaaaatttatcccatcatgaaatgggagcttatactggagagatcgctcct
tccatgctagccgatctaggttgccgtttcgtcattataggtcactccgagcggcgtacc
ctgtacggagaaacggacagcctcgtggctgaaaaggctattgctgcccagaaggtagat
attattcccatcatttgtgttggtgaaaccctacaagagcgcgaacagaatattactgag
caagttgtagagcgccagctaaatgctgttttacaacttgctggcgttaacgccttgaag
aaagctgttattgcctatgaaccgatatgggccattggtaccggccgcaccgcaactccc
gagcaagcccaggaggtgcatgctttcattcgaggtcatgtggcggttcaaaattccggt
atagctgaggaattactcgtcctctatggtggtagcgttaaaggaagcaatgcggcgcaa
ttattggcgatgccggatattgatggcggtttgattggcggggcctccctgaatgccaaa
gaatttctgacaatctgccaagcggcagtctaa

DBGET integrated database retrieval system