KEGG   Nitrosococcus watsonii: Nwat_0637Help
Entry
Nwat_0637         CDS       T01266                                 

Definition
(GenBank) Indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
nwa  Nitrosococcus watsonii
Pathway
nwa00400  Phenylalanine, tyrosine and tryptophan biosynthesis
nwa01100  Metabolic pathways
nwa01110  Biosynthesis of secondary metabolites
nwa01130  Biosynthesis of antibiotics
nwa01230  Biosynthesis of amino acids
Module
nwa_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:nwa00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Nwat_0637
Enzymes [BR:nwa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Nwat_0637
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS NanE QRPTase_C His_biosynth FMN_dh AAA_32 ThiG
Motif
Other DBs
NCBI-ProteinID: ADJ27593
JGI: Nwat_0637
UniProt: D8KB59
Position
complement(660205..661017)
Genome map
AA seq 270 aa AA seqDB search
MEGTRDMSEIPNLLKKILQRKAEEISERAQKLSIQELSQQVEESPPVRGFFKALTKKISE
QQSAVIAEIKKASPSKGLLCKSFHPEAIAQSYEKGGAACLSVLTDQDFFRGSEGDLQKAR
SSCNLPVLRKDFIIDPYQVYESRVIGADCILLIVAALGDALMLELAQLAEHLNMDVLIEV
HNSEELERALVLDTPLIGINNRDLRSFETRLETTFDLLPQIPPERLVVTESGIHSPADVR
KMKKNGVNAFLIGEAFMKAEDPIAKLTALL
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atggaaggtacccgtgatatgagcgagatacccaatctgttgaagaagattctgcagcgg
aaagccgaggaaatcagcgaacgtgcccagaaactttcaatccaagaacttagccaacaa
gtggaagaatcgcccccagtacgcggattttttaaagccctgaccaaaaagataagcgag
cagcaatctgctgtcatcgctgaaattaaaaaagcttcccctagcaaggggcttttatgt
aaatccttccatccggaagcgattgcccaaagctacgaaaaaggaggggcagcttgcctt
tccgtactcaccgaccaggatttttttagaggtagtgagggggatctacagaaggcccgc
agctcctgtaatctgcctgttttgcgaaaagactttattatcgatccctatcaggtctat
gaatcacgggtaataggcgccgactgcattctacttattgtagcagccttgggtgatgcc
cttatgctcgagctggctcaactcgccgagcacttaaatatggatgtacttatagaagtg
cataattccgaagagctagagcgggcgctagttctcgacacaccacttatcggcattaat
aaccgtgatttaagaagctttgaaacaaggctagaaactacttttgacttactcccccag
atacctcctgagcgtttagtagtcacagaaagtgggattcatagtcccgcagatgtaaga
aagatgaaaaaaaatggggttaacgcctttcttatcggagaagccttcatgaaagcggaa
gatcccatagctaaacttacggcattgctctga

DBGET integrated database retrieval system