KEGG   Nitrosococcus watsonii: Nwat_0656Help
Entry
Nwat_0656         CDS       T01266                                 

Definition
(GenBank) asparagine synthase (glutamine-hydrolyzing)
  KO
K01953  asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
nwa  Nitrosococcus watsonii
Pathway
nwa00250  Alanine, aspartate and glutamate metabolism
nwa01100  Metabolic pathways
nwa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nwa00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Nwat_0656
Enzymes [BR:nwa01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     Nwat_0656
Peptidases [BR:nwa01002]
 Cysteine Peptidases
  Family C44
   Nwat_0656
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asn_synthase GATase_7 GATase_6 QueC NAD_synthase DUF3700
Motif
Other DBs
NCBI-ProteinID: ADJ27612
JGI: Nwat_0656
UniProt: D8KB78
Position
679324..681306
Genome map
AA seq 660 aa AA seqDB search
MCGFAGFYDSSLPTDQAEKILTKMASRLVHRGPDDRGIWLERETGVHLAHRRLAVVDLSA
SGHQPMLSASGRYVIVFNGEIYNYKALRTELEGRETPWYGHSDTEVLLAGIEVWGLSETL
RRCVGMFALALWDRKARVLYLARDRLGEKPLYYGWMKGAFLFGSELKAFHIHPAWQGEID
RKAVTLLMRHNYIPSPFSIYQGIYKLPPGCFLALSWESLRANKALVPFPHEGDRSAPQPY
WSAWKAVENGAAVPFRGSDEEAIAELERRLRVTVAGKMAADVPLGAFLSGGIDSSMVVAL
MQAQSSQPIRTFSIGFHEEGYNEAVHAAQVAHHLGTDHTELYVSPEEAMAVIPRLPSIYD
EPFADSSQIPTFLVSQLARRYVTVALSGDGGDELLGGYNRYFWCQQIWGKLGKFPRLGRQ
LAAQMPRILPPLVWDKIFAGLDPLLPTRFRQAHPGDKLHKLAAILASDSPAVIYEQLISQ
WQNPDSIVINGFEPSGLANKVWSYPVLTNLTERMMFLDLMTYLPDDILTKVDRASMAVSL
ETRVPLLDHRLVEFVWRLPLGLKVRGGTGKWILRQVLYRYVPETLVERPKMGFGVPIDLW
LRGPLRHWAEDLLDVSKLRREGYFYPEPIRRKWEEHLSGRRNWQYPLWCVLMFQAWLDAQ
NT seq 1983 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggctttgcagggttttatgattcttcgttaccgacggatcaggcggaaaaaatt
ctcactaaaatggcttcgcgcctggttcatcgaggaccagacgatcgagggatttggcta
gaacgggagacgggcgttcatctcgctcataggcgcttagcggtggtggatctttccgcc
agcggtcatcagcccatgctgtctgctagtggccgttacgtgattgtctttaatggggaa
atttataattataaagctctgaggacagagctagaaggaagagaaaccccgtggtatggc
cattcggataccgaggttttgttggcggggattgaggtgtggggactaagcgaaactctg
cggcgttgtgtgggtatgtttgccctggccctctgggatagaaaggcgcgggtgctttat
cttgctcgagaccggctgggagaaaaacccttatattacggctggatgaagggagctttt
ttgtttggttccgaactcaaggcgttccacatccatccagcttggcagggggaaatagat
cggaaagcggtgacgcttctgatgcgccataattatattcctagccctttttctatttac
caaggaatctataaacttccgccgggatgttttttagcgttaagttgggaaagtttaagg
gcaaataaggcacttgtcccctttccacacgagggagaccggagcgcgccgcaaccttat
tggtccgcctggaaggcggtggaaaacggggcggcagtcccttttaggggcagtgatgaa
gaggccatcgctgaactggagaggcggctacgggtaaccgtagccggtaagatggccgct
gatgtccctctcggcgcctttctctccggggggatcgactcctctatggtggttgccctg
atgcaagcccaaagcagccagcccattcgaactttctctattggtttccacgaggagggc
tataatgaagcggttcatgctgctcaagtggcccatcatttaggcaccgatcatactgaa
ctctatgtcagtccggaggaagccatggccgtgatcccccggcttcccagcatttacgat
gaaccttttgctgattcttctcaaattcccacttttctggtgtcccaactggcacggcgg
tatgttaccgtggccctgtctggagatggaggcgatgagctgctagggggctataatcgc
tatttctggtgccagcagatttggggtaagctaggcaaatttcctcgcctcgggcgtcag
ttggctgcccaaatgccgcggatccttccccctttagtttgggataagatttttgcaggt
ctggaccccctcttgccaacccgattccggcaagcccatccgggtgataaactgcataag
ctagcggccattttggcgtcggactctccagcggttatttatgagcagctcatttcccag
tggcagaatcctgacagcattgttatcaatggtttcgagccttcgggtttggctaataag
gtttggtcctatcccgtactgactaatcttaccgaacggatgatgtttttggatctgatg
acctatcttcccgatgatatcctgactaaggtggatcgggcgagtatggcggtaagtttg
gagacccgtgttccgctgcttgatcatcgcttggtggagtttgtctggcgcttgccgctt
gggttgaaggtccggggggggacaggcaagtggatattgcgtcaggttttatatcgttat
gttcctgagacgttggtagaacgcccaaagatgggttttggggttcctattgacctgtgg
ttacgtggtccgctgcgccactgggcggaagatttacttgatgtcagcaaacttaggaga
gaaggatatttctaccctgagcctatccgtagaaagtgggaggagcatctcagcgggcgg
cgtaactggcaatatcccctgtggtgcgttttgatgtttcaagcttggttagacgctcag
taa

DBGET integrated database retrieval system