KEGG   Nitrosococcus watsonii: Nwat_0662Help
Entry
Nwat_0662         CDS       T01266                                 

Definition
succinate dehydrogenase hydrophobic membrane anchor protein
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
nwa  Nitrosococcus watsonii
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:nwa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Nwat_0662
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Nwat_0662
   00650 Butanoate metabolism
    Nwat_0662
  Energy metabolism
   00190 Oxidative phosphorylation
    Nwat_0662
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
685690..686019
Genome map
AA seq 109 aa AA seqDB search
MKGVMSGLRAWLAQRGTAVTMLVLLLLFLARLMQDSFPTYEAWRAWINDPLVSIMVALFF
GALLLHSWIGLRNIILDYVDPTPLRLLAHFLVVVVYSAIGFWVIRILLR
NT seq 330 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaggagtaatgagcggactgcgcgcttggctggcgcagcgtgggacagctgtcacc
atgctggtgttgttgctactttttcttgcccgcctgatgcaggactcctttccgacctat
gaggcttggcgggcatggattaacgatcccctggtgagtattatggtggcgctttttttt
ggtgctctgctgttgcactcctggatagggttgcggaatattattttagactatgtggat
cctacgccattgcgcttgcttgcccatttcttggttgtggtagtgtatagcgcaataggt
ttttgggttattaggatattgttgagatga

DBGET integrated database retrieval system