KEGG   Nitrosococcus watsonii: Nwat_0681Help
Entry
Nwat_0681         CDS       T01266                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
nwa  Nitrosococcus watsonii
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:nwa01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:nwa00260]
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism [PATH:nwa00750]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
703770..704861
Genome map
AA seq 363 aa AA seqDB search
MPFRSRYTGLIDKYRDRLPVHDDTRVISLGEGNTPLIRLNNIPRMLGQEVDIYIKYEGLN
PTGSFKDRGMTMAVTKAVEEGSRAIICASTGNTSASAAAYAARAGIIAFVLIPEGKIAHG
KLAQAMMHGAIVIQIKGNFDKGMQLVKEVAGKAPVTIVNSINPYRIQGQKTAAFEIIEEL
ECAPDFHCLPVGNAGNITAHWLGYSEYHAHGIVNTRPRMCGYQASGAAPFLEGKMVDQPE
TVATAIRIGHPQSWDKAWKAQEESQGWFSACTDEEILAAQKLLAEREGVFCEPASAAGLA
GAMRDIEAGKIPSDSKIVCTLTGHGLKDPDTAIAQSKAPLVAVEARLESVQKAILDNLKG
ADT
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgccatttcgatctcgttatacgggccttattgataaatatcgggaccgtttaccggtc
catgacgatacccgggtaataagcctaggagagggaaatacgccccttattaggctgaat
aatattccgcgaatgttgggccaggaggttgatatttatattaagtatgaaggactcaac
ccgacgggttcttttaaagaccgtggaatgaccatggctgttacgaaggctgtcgaggag
ggcagccgcgctattatttgcgcttccacgggtaatacctcagcctcggcggccgcctat
gcggcccgagcgggaattatcgcctttgttcttatcccggagggtaaaattgcccatggc
aagcttgctcaggccatgatgcatggagcgatcgtgatccaaatcaagggtaactttgat
aaggggatgcaattagtcaaggaagtggcgggtaaggcgcccgtgactattgtgaattct
attaatccttaccggattcaggggcaaaaaacggcggctttcgagatcattgaagaattg
gaatgcgctcctgattttcactgtttgccagtgggcaacgcgggcaatattaccgcccat
tggctaggttatagtgaatatcacgcccatggaattgtcaatacccggccccgcatgtgc
ggctatcaggccagcggggcagcgccctttcttgagggtaaaatggtggaccaaccggaa
acggttgcgaccgctatccgtattggccatcctcaaagctgggataaagcatggaaagca
caggaagaatcccagggttggtttagcgcctgtacggatgaagagatcttggcggctcaa
aaattgcttgcggaaagggaaggcgtattttgcgaacctgcttcagccgctggattagct
ggagcgatgcgggatatcgaagcaggtaaaatacccagtgatagtaaaatcgtttgcacc
ctcactggccatggtttaaaagatccggataccgccatcgctcagagcaaagcgccccta
gtagcggttgaagcgcgcctagagtcggttcagaaggctattttagataatttgaaaggg
gctgacacctaa

DBGET integrated database retrieval system