KEGG   Nitrosococcus watsonii: Nwat_0681Help
Entry
Nwat_0681         CDS       T01266                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
nwa  Nitrosococcus watsonii
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:nwa00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Nwat_0681
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Nwat_0681
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Nwat_0681
Enzymes [BR:nwa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Nwat_0681
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
703770..704861
Genome map
AA seq 363 aa AA seqDB search
MPFRSRYTGLIDKYRDRLPVHDDTRVISLGEGNTPLIRLNNIPRMLGQEVDIYIKYEGLN
PTGSFKDRGMTMAVTKAVEEGSRAIICASTGNTSASAAAYAARAGIIAFVLIPEGKIAHG
KLAQAMMHGAIVIQIKGNFDKGMQLVKEVAGKAPVTIVNSINPYRIQGQKTAAFEIIEEL
ECAPDFHCLPVGNAGNITAHWLGYSEYHAHGIVNTRPRMCGYQASGAAPFLEGKMVDQPE
TVATAIRIGHPQSWDKAWKAQEESQGWFSACTDEEILAAQKLLAEREGVFCEPASAAGLA
GAMRDIEAGKIPSDSKIVCTLTGHGLKDPDTAIAQSKAPLVAVEARLESVQKAILDNLKG
ADT
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgccatttcgatctcgttatacgggccttattgataaatatcgggaccgtttaccggtc
catgacgatacccgggtaataagcctaggagagggaaatacgccccttattaggctgaat
aatattccgcgaatgttgggccaggaggttgatatttatattaagtatgaaggactcaac
ccgacgggttcttttaaagaccgtggaatgaccatggctgttacgaaggctgtcgaggag
ggcagccgcgctattatttgcgcttccacgggtaatacctcagcctcggcggccgcctat
gcggcccgagcgggaattatcgcctttgttcttatcccggagggtaaaattgcccatggc
aagcttgctcaggccatgatgcatggagcgatcgtgatccaaatcaagggtaactttgat
aaggggatgcaattagtcaaggaagtggcgggtaaggcgcccgtgactattgtgaattct
attaatccttaccggattcaggggcaaaaaacggcggctttcgagatcattgaagaattg
gaatgcgctcctgattttcactgtttgccagtgggcaacgcgggcaatattaccgcccat
tggctaggttatagtgaatatcacgcccatggaattgtcaatacccggccccgcatgtgc
ggctatcaggccagcggggcagcgccctttcttgagggtaaaatggtggaccaaccggaa
acggttgcgaccgctatccgtattggccatcctcaaagctgggataaagcatggaaagca
caggaagaatcccagggttggtttagcgcctgtacggatgaagagatcttggcggctcaa
aaattgcttgcggaaagggaaggcgtattttgcgaacctgcttcagccgctggattagct
ggagcgatgcgggatatcgaagcaggtaaaatacccagtgatagtaaaatcgtttgcacc
ctcactggccatggtttaaaagatccggataccgccatcgctcagagcaaagcgccccta
gtagcggttgaagcgcgcctagagtcggttcagaaggctattttagataatttgaaaggg
gctgacacctaa

DBGET integrated database retrieval system