KEGG   Nitrosococcus watsonii: Nwat_0695Help
Entry
Nwat_0695         CDS       T01266                                 

Definition
acireductone dioxygenase
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
nwa  Nitrosococcus watsonii
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nwa00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Nwat_0695
Enzymes [BR:nwa01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.53  acireductone dioxygenase (Ni2+-requiring)
     Nwat_0695
    1.13.11.54  acireductone dioxygenase [iron(II)-requiring]
     Nwat_0695
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
717082..717624
Genome map
AA seq 180 aa AA seqDB search
MSILKIYHENDPSEAQIYKEFDEITQFMEGIGVCFQRWEAQKPLSSEAPQEEILSAYRTP
VDQLCQEYGFKSVDIISVKPDHPEKQALREKFLSEHTHSDFEVRFFVEGKGQFYLHAQGK
VYALLCEQGDFLSVPAGLPHWFDMGENPNLTCIRLFTTPEGWVANFTGNDIADHFPRLTQ
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atgagtatattgaaaatctaccatgaaaatgacccttccgaggctcaaatttataaagaa
tttgatgagataactcaattcatggaggggattggagtgtgttttcaacgatgggaagcg
caaaagcctttatcctcggaagctccccaagaggaaattctgtccgcctatcgaactccc
gtggatcagctctgccaagaatatggatttaagtcagtagatatcattagcgttaagccc
gatcatccggaaaagcaagcgctgcgggaaaaattcctaagcgagcacactcacagcgat
tttgaggtacgtttctttgtggaaggaaaagggcaattttatcttcatgctcagggcaag
gtgtatgccttgctatgtgagcaaggggatttcctgagcgtgcccgcgggtttgcctcac
tggtttgatatgggggagaatccaaacctgacatgtattcgtctctttaccacgccagag
gggtgggttgccaattttaccggcaatgatattgctgaccattttccccgcctaacccag
taa

DBGET integrated database retrieval system