KEGG   Nitrosococcus watsonii: Nwat_0773Help
Entry
Nwat_0773         CDS       T01266                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
nwa  Nitrosococcus watsonii
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:nwa00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
794496..795977
Genome map
AA seq 493 aa AA seqDB search
MRAILVEGMRGVKARPFQRRHGGVLLHVTSLPGSNLGIDAYRFVDFLVEAGITVWQILPL
GPTHEDLSPYQCLSVHAGNPKLISLRCLVEEPWFGICDIDLNDCGAALWQGYRRFTLYAS
QAMQAEFAAFCREQAFWLEDYVLFQALRETQDNAPWFEWPQKLHGHAFKELGVVGKELET
LMDRNRFEQFIFFRQWSRLKNYANGHGVFIFGDMPIFVAHDSADVWAQPEYFTVDKGGQL
TVMAGVPPDYFSATGQCWGNPLYQWDRLEDDGFGWWLERVRTQLRLCDIIRIDHFRGLES
YWEIPASSKTAVKGRWVKAPGEALFRALEDSYGSLPLVAEDLGIITPAVDALRDQFHLPG
MKVLQFAFEGGSDNPYLPENYLENCVVYTGTHDNDTTLGWFNKLSEDKRHYIYEYLGFPS
EPMPWALIECAFQSIAKHAVVPMQDLLELGSEGRMNLPGMIDNNNWRWHFNWPQVKPDLA
ARIRYLVRHYDRL
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgcgggcaattcttgttgaggggatgaggggggtgaaagctaggccatttcaacggcgg
catgggggggttttacttcatgtcacgtctttgccaggcagcaatctaggtatagacgct
taccgttttgtggattttctagtggaagccgggattactgtttggcagattcttccacta
gggccaacccacgaggatctatctccctatcaatgtctctcggttcatgccggtaatcca
aaattgatctctttgcgatgcttggttgaggagccttggtttggtatctgtgatatcgat
ttgaacgattgtggggctgcgctatggcaaggttatcgccgcttcactctctatgctagc
caggcgatgcaggctgaatttgctgctttttgtcgtgagcaagctttttggctagaggat
tacgttttatttcaagccttgcgggagactcaggataatgctccttggtttgaatggcct
caaaagctgcacggacatgcgttcaaggagcttggagtggtggggaaggagctagagact
ctgatggatcgtaaccgcttcgagcaattcattttctttcgacaatggtcaaggcttaaa
aattacgctaacgggcatggggtatttatctttggtgatatgcctatttttgttgctcac
gatagtgctgatgtttgggctcaaccagaatatttcaccgtggataaggggggtcagtta
acggtaatggcgggagtgccccccgattatttttcagcaactggccagtgctggggtaac
cctttataccaatgggatcgtcttgaggatgacggctttggttggtggttagaacgggtg
cgcacccagttaaggttgtgcgatattattcgtattgaccattttcgtggccttgagtcc
tactgggaaatcccggctagtagcaaaacagcggttaaggggcgttgggtaaaagcgcct
ggcgaagccctgtttcgcgccctagaggattcttatggatctttgccattggtagctgaa
gatttagggattattaccccagcggtagatgcattacgggatcagtttcatttacctgga
atgaaagttttacaatttgcttttgagggcggatcggataatccttaccttcctgagaac
tatttggaaaattgcgtagtgtatacaggcactcatgataacgatactaccttgggctgg
ttcaacaagctctctgaagataagcgccactatatttatgaatacctaggatttccatct
gagcctatgccgtgggcgctaattgaatgtgctttccagtcaatagctaagcatgcggta
gtgccaatgcaagatcttttggagttgggcagcgaggggcgcatgaatttacctggaatg
atcgacaataataattggcgctggcattttaattggccacaggtaaaacccgatctagca
gcacgcatacgatatttggttaggcattatgaccggctataa

DBGET integrated database retrieval system