KEGG   Nitrosococcus watsonii: Nwat_0903Help
Entry
Nwat_0903         CDS       T01266                                 

Definition
glycoside hydrolase family protein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
nwa  Nitrosococcus watsonii
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nwa00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Nwat_0903
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    Nwat_0903
Enzymes [BR:nwa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Nwat_0903
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
939156..940181
Genome map
AA seq 341 aa AA seqDB search
MTLGPLMVDLKGVTLDSEERAWLGHPWVGGVILFSRNYESPEQIAALIKAIHALKKPRLL
VAVDHEGGRVQRFRDGFTLLPSASLLGKLYDRDQRQAQRLAMTTGWLMAVELRAIGVDVS
FAPVLDLAQGVSAVIGDRAFHAEPDAVIALARAYIRGMAWAGMAAVGKHFPGHGSVVADS
HTVLPVDERPWRQIRERDLLPFEYLVKAGLPAVMPAHVCYASVDARPAGFSPFWLETVLR
GQLGFQGAIISDDLSMAGAAEVGNMSARVRTVLGAGCDMALVCNDPDGYALLLDELNGDP
YPQIPARLLRLYGRYPLTRSRLYRSPAWQKAVRTLAAYGKF
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgactctaggccctttgatggttgatttaaaaggcgtaaccctggactcggaggaacgg
gcgtggttagggcatccttgggtgggcggagtcattttatttagccgtaactatgaatcg
ccggaacaaatcgcagcgttgatcaaggcgattcacgcactcaagaaacctcgtctattg
gtagctgtggatcatgaaggaggacgtgtacagcgtttccgggatggttttaccctttta
ccgtcggcctctctcctgggtaagctttatgatcgggatcagcgccaagcccagcgttta
gcaatgacaaccggctggctaatggcggttgagttgcgagcaattggcgttgatgttagt
tttgcccccgtcttggatttagctcagggagtcagcgcggtgataggggatcgagccttt
cacgcagagcctgacgccgtgatagccttagctagagcttatatccgagggatggcctgg
gcgggcatggctgcggtgggtaaacactttccgggacatgggtcagtggtggccgactcc
catacggtgctccccgtggatgaacgtccctggcggcagattcgggagagggatctcttg
ccctttgaatatctggtgaaagccggcttaccagcagtcatgcccgcccacgtgtgctat
gcttcagtggatgcccgccccgccggtttttcccctttctggctggagaccgtcttgcgt
gggcaactgggctttcaaggcgccattattagcgatgatttgagcatggctggcgcagcg
gaagtagggaatatgagcgcgcgggtacggacggttttaggtgccggctgcgatatggcc
ttagtctgtaatgatcctgacggttatgctctcttattggatgagctgaacggggaccct
taccctcagattcccgcccgcctgcttcggctctatggccgctatccgctaacccgctcc
cggttataccgtagccccgcctggcaaaaagcggtgcggacgcttgctgcctacggcaag
ttttag

DBGET integrated database retrieval system