KEGG   Nitrosococcus watsonii: Nwat_1096Help
Entry
Nwat_1096         CDS       T01266                                 

Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
nwa  Nitrosococcus watsonii
Pathway
nwa00230  Purine metabolism
nwa01100  Metabolic pathways
Module
nwa_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:nwa00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Nwat_1096
Enzymes [BR:nwa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Nwat_1096
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_25 AAA_33 AAA_16 AAA DUF3734 RsgA_GTPase AAA_18 DnaB_C
Motif
Other DBs
NCBI-ProteinID: ADJ28030
JGI: Nwat_1096
UniProt: D8K553
Position
1158929..1159540
Genome map
AA seq 203 aa AA seqDB search
MSGSLFIVAAPSGAGKTSLVKALAASIADIRLSISHTTRPPRPGERDGMDYHFVTEAIFE
TMQRGGGFLEHAQVFGHRYGTAKKSVLPLLAQGLDVILEIDWQGRRQVQAQFPHCVSIFI
LPPSRETLEHRLRLRGQDTEAVVARRMGDACAEISHYNEFDYLVVNDNFEVACADLMTIV
QSRRLLRLRQEKKLKSLLGELLG
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgtctggcagcctatttatcgttgcagctccctccggcgctgggaaaaccagcttggtc
aaggcgctggcagcctcgatagccgatattcgcctttccatttctcatacaacccgtcct
ccgcggccaggagaacgagatggaatggattatcactttgttaccgaagccatctttgaa
accatgcagcggggaggtggtttcttagagcatgcccaagtgtttggacatcgctacggt
acagccaaaaaaagcgtgcttccgcttttggcgcaaggcttggatgtcattctcgagatt
gattggcagggaagacgccaggtgcaagcgcaatttcctcactgtgtgagcatctttatt
ttgcccccttcccgggagaccctagagcacaggctgcgcctccggggacaagatacggaa
gccgtggttgcccgccggatgggggacgcgtgtgccgagatttctcactataatgagttt
gattacctggtggtcaatgataactttgaggtagcatgtgcggatttgatgactattgtt
caaagtcggcgtttgctgcgtttacggcaagagaaaaagttaaaatccctattaggcgag
ctattagggtga

DBGET integrated database retrieval system