KEGG   Nitrosococcus watsonii: Nwat_1096Help
Entry
Nwat_1096         CDS       T01266                                 

Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
nwa  Nitrosococcus watsonii
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:nwa00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1158929..1159540
Genome map
AA seq 203 aa AA seqDB search
MSGSLFIVAAPSGAGKTSLVKALAASIADIRLSISHTTRPPRPGERDGMDYHFVTEAIFE
TMQRGGGFLEHAQVFGHRYGTAKKSVLPLLAQGLDVILEIDWQGRRQVQAQFPHCVSIFI
LPPSRETLEHRLRLRGQDTEAVVARRMGDACAEISHYNEFDYLVVNDNFEVACADLMTIV
QSRRLLRLRQEKKLKSLLGELLG
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgtctggcagcctatttatcgttgcagctccctccggcgctgggaaaaccagcttggtc
aaggcgctggcagcctcgatagccgatattcgcctttccatttctcatacaacccgtcct
ccgcggccaggagaacgagatggaatggattatcactttgttaccgaagccatctttgaa
accatgcagcggggaggtggtttcttagagcatgcccaagtgtttggacatcgctacggt
acagccaaaaaaagcgtgcttccgcttttggcgcaaggcttggatgtcattctcgagatt
gattggcagggaagacgccaggtgcaagcgcaatttcctcactgtgtgagcatctttatt
ttgcccccttcccgggagaccctagagcacaggctgcgcctccggggacaagatacggaa
gccgtggttgcccgccggatgggggacgcgtgtgccgagatttctcactataatgagttt
gattacctggtggtcaatgataactttgaggtagcatgtgcggatttgatgactattgtt
caaagtcggcgtttgctgcgtttacggcaagagaaaaagttaaaatccctattaggcgag
ctattagggtga

DBGET integrated database retrieval system