KEGG   Nitrosococcus watsonii: Nwat_1143Help
Entry
Nwat_1143         CDS       T01266                                 

Definition
catalytic domain of components of various dehydrogenase complexes
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
nwa  Nitrosococcus watsonii
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:nwa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Nwat_1143
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Nwat_1143
   00020 Citrate cycle (TCA cycle)
    Nwat_1143
   00620 Pyruvate metabolism
    Nwat_1143
Enzymes [BR:nwa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Nwat_1143
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1214956..1216305
Genome map
AA seq 449 aa AA seqDB search
MVREFKLPELGENVESGDVAKVLVSPGDTLEKDQPVLELETDKAVVEIPSTVSGKIKELK
VEIGDQVAIGQVILTLEEGEEDIQEEAPAAKEEAKPEQDDKPSEKNAAVTGGQQPAPKVS
RMEAREERGIKRDEITAAPETTVSAPAPATPSVRRLARELGVDIHEVTGSGPGGRISGDD
VKHYVRALVSQRTTPSSAPGVVSQATPFLPLPAFEKWGAVEREPMSKIRRKTAEQMSQAW
TIPHVTQHDQADITRLEQARKRLARRVEQAGGKLTLTAIALKVVAAALRAFPRFNTSIDV
DAKELVYKQYCHIGVAVDAEHGLLVPVLREVDQKNIAQLAVELTELAEKARSRKIGPEEM
AGGSFTITNLGGLGGSYFTPIINWPEVAILGLSRAKLTPLYREGELQPRLLLPLSLSYDH
RVIDGADAVRFLRWIAEALEDPLLLSLEG
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
gtggtgcgtgaatttaagcttcccgaattaggcgagaatgttgaatctggtgatgtggcc
aaagtgctggtatctccaggagatactttagaaaaggatcaaccggttttagaacttgaa
accgacaaggcggtagtggaaatcccttcaacagttagcggtaagatcaaggagttaaag
gttgaaataggagatcaagtggccattggccaagttattcttaccttggaagaaggggaa
gaggacatccaagaggaggctcctgctgctaaagaagaggcaaagcctgagcaggatgac
aaaccctctgaaaaaaacgcagccgtaacaggtggccagcagccagcacctaaagtctct
cgaatggaggctcgcgaggagagggggataaagagggatgagatcacagccgcccctgaa
acaacggtttcggcgcctgctccagcgaccccatcagtgcggcgattagctcgggagctc
ggcgttgatattcacgaggtcacagggtctggcccgggtgggcggatttccggggatgat
gtgaagcattatgtccgtgctttggtatcccagcggaccacgccatcatcagctcccgga
gttgtttctcaagcgactcccttccttcccctgccagcgtttgaaaaatggggtgcggtg
gagcgggagcccatgagcaagatacgccgcaagacggcggagcaaatgagccaagcctgg
actattccccatgtgacccagcatgatcaggcggatattacccggcttgagcaagcccgg
aagcgtcttgctaggcgggtagagcaagcaggcggcaaactcaccctgaccgctattgcc
ttgaaggtagttgctgccgcactgcgagctttcccccgctttaatacatccatagatgtg
gacgctaaagagctggtctataaacagtattgtcatatcggcgtggcggtggatgcggag
catggcctgctggtacccgtccttcgggaggtcgatcaaaaaaatatcgcgcagctagcg
gtagagctaacagagcttgccgagaaggcgagaagccgaaaaatcggtcccgaggaaatg
gccggaggttcttttaccattaccaacctgggtggtttaggcggctcctattttaccccc
attattaattggccggaggttgctattttgggtctctcccgagctaagttgactcccctt
tatagagaaggagaacttcagccccggctgcttctgcccctttctctgtcttatgaccat
cgggtcattgatggcgccgatgcggttcgttttttgcgctggattgcggaagcgttggaa
gatcccctcttgctgtccttggaggggtag

DBGET integrated database retrieval system