KEGG   Nitrosococcus watsonii: Nwat_1152Help
Entry
Nwat_1152         CDS       T01266                                 

Definition
cytochrome c peroxidase (EC:1.11.1.5)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
nwa  Nitrosococcus watsonii
Brite
Enzymes [BR:nwa01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     Nwat_1152
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1227170..1228246
Genome map
AA seq 358 aa AA seqDB search
MKKFAFCLVLIIGTAYASHVLAKKHGDELMQQAQSLFKPIPTELQEIEGITLTPERIELG
KWLYFDPRLSRSWLISCNTCHNLALGGVDLEETSIGHGWAKGPRNAPTVLNSVFNFAQFW
DGRAEDLQAQAKGPVQAGVEMNNTPERVEQTLKSIPEYVQRFRKAFPDDSNPVTFDNMAD
AIEAFEATLLTPGSPFDQYLNGDSQVLSKAQKKGLKLFMNKGCSSCHNGINVGGGSYQPF
GVVEKPGSKILPEKDQGRFTVTETASDKYVFKVPSLRNIELTPPYFHSGQVWDLEQAVAI
MGSSQLGIKLSRNETAAIVTFLKTLTGEQPRVEYPILPPHTKGTPLPVIGVSSNAAGH
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaatttgctttctgtttagtgctgataataggaacggcttatgctagccatgtt
cttgccaaaaagcatggtgacgagctgatgcagcaggcccagtccctatttaaaccgatt
cccaccgagctgcaggagatagagggaattacgctgacgccagagaggattgagctgggt
aaatggctttattttgatcctcgcctctccagaagctggctaattagctgtaatacttgc
cataatcttgcccttggtggagtggatctagaagaaacttctattggccatggatgggca
aagggaccccgtaatgcgcctacggtactcaattccgtattcaattttgctcaattctgg
gatgggcgggcggaagatctccaagctcaggcgaaaggaccggtgcaggcgggcgtagag
atgaataatacgccggagcgggtggagcagactctgaaaagcatcccggaatatgttcag
cgctttcggaaggcctttcccgatgactctaaccccgtcactttcgataatatggcggat
gctatcgaagcttttgaagccactctactgactcctggatctccttttgatcaatacctt
aacggtgattcccaggtactgtcgaaagcacaaaaaaaggggcttaaactctttatgaat
aaaggctgctcaagctgccacaatggaattaatgtgggtgggggaagctatcaacccttt
ggggttgtagaaaaacccggcagcaaaattcttccggaaaaagatcaagggcggtttacg
gtgacggaaacagccagcgataagtacgtttttaaagtcccttctttgcgtaatatagag
ttaactcctccctattttcattctggacaggtatgggatctagaacaggcagttgctatt
atgggctcatcacagcttggtataaaacttagccgtaatgaaaccgccgctattgtaact
ttcttgaaaaccttaactggcgagcaacccagggtggaatatcctattcttccaccccat
actaaaggaactccgctgccggtgatcggggtttctagcaatgccgccgggcattaa

DBGET integrated database retrieval system