KEGG   Nitrosococcus watsonii: Nwat_1199Help
Entry
Nwat_1199         CDS       T01266                                 

Definition
phosphoenolpyruvate phosphomutase
Orthology
K01841  
phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
nwa  Nitrosococcus watsonii
Pathway
Phosphonate and phosphinate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:nwa00001]
 Metabolism
  Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    Nwat_1199
Enzymes [BR:nwa01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     Nwat_1199
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1293082..1294752)
Genome map
AA seq 556 aa AA seqDB search
MSTVPLPAAEPFKDRPSKFAQLRALLESKPTEFLLEAHNGLSARIAEEAGFKGIWASGLA
ISSQFGVRDNNEASWTQIVDMLEFMSDATTVPILLDGDTGYGNFNNLRRLVKKLEQREIA
GVCIEDKIFPKTNSFIGGERQPLAEIDEFCGKIKAGKDSQSDPNFSIVARVEALIAGWGL
DEALRRAEAYHRAGADAILIHSKLSQADEILAFAREWGNRAPLIIVPTKYYSTPTEVFRK
AGISTVIWANHLIRAAAAAMAQVAREIHATQTLVNIEDRVAPVSEIFRLQGAEELLAAER
RYSTAPEAETGAIVLGATQGKGLESLTQERPKVMLPVAGIPLLRRLVDEFKRQHINRITV
VTGYKPEAIDVKGISLIHNPDYGHSSELSSLACALESLTEDTIITYGDLLFRSYILNDLR
HVPGNIVVVVDSALSPGMKDDIRDVAFCSQPDDRSLFRQDVDLLRIEAQKEQLGKQSHGR
WIGMVRVAGEGRQWLLDALQALRQQENFPQLAMPDLFNHLVASGHPIKVLYINGHWLDVN
NMEDLTRAGDFAHGHQ
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
atgagcactgtacccttgcccgcggctgaaccttttaaagaccgaccttcaaaatttgcc
caattacgggctttgttggaatctaaacctacggagtttttactggaagcccacaatggc
ctcagtgcccgaattgctgaagaagccgggtttaagggaatttgggccagcggcctggct
atttcttcccagtttggcgtgcgggacaataatgaggctagctggacccagatagtggat
atgctggagtttatgtccgacgctactaccgttcctattctcctggatggcgatacaggc
tatggaaactttaataacttgcgccggttggtgaaaaagctagaacaaagggagattgcc
ggcgtttgtatcgaagataaaatctttcctaaaactaacagcttcattggtggcgagcgc
cagcctttagctgagatagacgaattctgcggcaagatcaaggctgggaaagattcccaa
agcgatccgaatttctccatcgtggcacgagtcgaagctttaatcgcgggctgggggctg
gatgaagccttgcgccgcgcagaagcttaccatcgggctggcgcggatgccatcttaatc
cacagtaagctctcccaagccgatgagattctggccttcgccagggaatggggaaaccgg
gcaccgctcattattgtccccactaaatactacagcacgcccaccgaggtattccgcaag
gcgggcatcagcaccgtcatttgggccaatcatttaattcgggccgcagcggccgcgatg
gcccaagtggcgcgggaaatccatgccacgcaaaccctggttaacattgaggatcgggtt
gcaccggtcagtgaaatcttccgtctccaaggagccgaagaattactagctgctgaacgc
cgctacagcactgccccagaagccgagacgggagcgattgtgttgggagccacccaaggc
aaagggctggaaagcctcactcaagaacgccccaaagtcatgctgccggtggctggcatc
ccactactacgccgcctggtagacgaatttaaacgccagcacattaatcgcatcacggta
gtgactggctataaaccagaagctattgatgtcaaagggatttccctcattcataatcca
gactacggccatagcagtgagttatcctcccttgcctgtgcccttgagagcttaacggaa
gataccatcattacctatggcgacctgctattccgcagctatatcctaaatgatttgcgc
cacgtgccaggaaacattgtggtcgtggtggattctgccctttctcctggcatgaaggat
gacatccgggatgtggctttctgctcccagcccgatgaccgttccttgttccgccaggat
gtggacctccttcgcattgaggcgcaaaaagagcagctcggtaaacaatcccacggtcgc
tggatcggcatggtacgagtcgcgggcgaaggacgccaatggctactcgatgctctccaa
gcgttacggcaacaagagaattttccccaacttgcaatgcccgatttattcaatcatctg
gtcgccagcggccatcctatcaaggttctctacattaacggccattggctggatgtaaac
aacatggaggatctaactcgcgctggcgactttgcccacggtcatcaataa

DBGET integrated database retrieval system