KEGG   Nitrosococcus watsonii: Nwat_1248Help
Entry
Nwat_1248         CDS       T01266                                 

Definition
(GenBank) isocitrate dehydrogenase, NADP-dependent
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
nwa  Nitrosococcus watsonii
Pathway
nwa00020  Citrate cycle (TCA cycle)
nwa00480  Glutathione metabolism
nwa01100  Metabolic pathways
nwa01110  Biosynthesis of secondary metabolites
nwa01120  Microbial metabolism in diverse environments
nwa01130  Biosynthesis of antibiotics
nwa01200  Carbon metabolism
nwa01210  2-Oxocarboxylic acid metabolism
nwa01230  Biosynthesis of amino acids
Module
nwa_M00009  Citrate cycle (TCA cycle, Krebs cycle)
nwa_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:nwa00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Nwat_1248
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Nwat_1248
Enzymes [BR:nwa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     Nwat_1248
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: ADJ28178
JGI: Nwat_1248
UniProt: D8K5K1
Position
1343203..1344471
Genome map
AA seq 422 aa AA seqDB search
MAYDKISLPSDGQPITVKEDFSLEVPARPLIPFIEGDGIGVDITPVMRQVVDKAIAVAYG
GERSLAWTEVYAGEKATRVYGTDEWLPAETLDALRQFVVSIKGPLTTPVGKGIRSLNVAI
RQVLDLYACIRPVRYFPGTPSPLADPSRTHMVVFRENTEDIYAGIEWPAQSPEAKKIIEF
LRQEMGVEKIRFPESSGIGIKPVSREGSQRLIRKALQYAIDNDRRSVTLVHKGNIMKFTE
GAFCDWGYALAQEAFGARPIDGGPWCEFTPPERGHKIIVKDAIADNFLQQILLRPEEYEV
IATLNLNGDYISDALAAQVGGIGMAPGANMGDRVAVFEATHGTAPKYAGQDRVNPSSIIL
SGEMMLRHLGWNEAADLIIQGITDALAARTVTYDLARLMEGATQVSCSGFGEAIMKHMAA
PA
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atggcttatgacaaaatctcccttccctccgatggccagcctattaccgttaaggaggac
tttagtcttgaagttcccgcccgcccgctcattccttttattgaaggcgatgggattggg
gtggatatcaccccggtgatgcgccaagtcgtcgataaagcaattgccgtggcctatggg
ggggagcgctccctggcctggaccgaggtctatgcgggggaaaaggcaacacgcgtgtac
ggcactgatgaatggctgccagcggagaccttggatgccttgcgacaattcgtggtgtct
atcaaaggcccccttaccacgccagtgggcaaaggtatccgttctttaaacgtggcgatc
cgtcaggtgctggatctctatgcctgcatccggccggttcgatattttccagggacgcca
agtcccttggccgatccttcccgcacccatatggtggtgtttagggaaaacaccgaagat
atctatgccggtatcgagtggccagcccagtcacccgaggcgaaaaaaattattgaattt
ctgcggcaagagatgggcgtggaaaaaatccgttttccggaaagctctggcattggcatt
aagcctgtgtcccgggaaggctcccagcgcctcatccgtaaagctttgcaatacgccatt
gataacgatcgccgttcagtgactctggtgcataagggtaacattatgaagtttactgaa
ggggctttttgtgactggggctatgcgctggctcaggaagcttttggcgcccgccccatt
gatgggggtccttggtgtgagttcacgcctcctgaaagggggcataaaattattgtcaaa
gacgccattgccgacaactttctgcaacaaattctgcttcgtcccgaagagtatgaggtc
attgcgactcttaatctcaatggagattacatctccgatgcgctagcggcccaggtgggc
ggaattgggatggcgccgggggcgaatatgggggatagggttgccgtgttcgaggcgacc
cacgggactgcgcctaaatatgcgggccaggatagggtcaaccccagcagcattattctt
tcgggggagatgatgttgcgccatctcggctggaatgaagcggctgatctgattattcag
ggtattacggatgccttggccgccaggacggtgacctacgacctggcccgattgatggaa
ggcgcgactcaagtctcgtgttctggcttcggggaagccattatgaagcacatggcagct
cctgcttag

DBGET integrated database retrieval system