KEGG   Nitrosococcus watsonii: Nwat_1248Help
Entry
Nwat_1248         CDS       T01266                                 

Definition
isocitrate dehydrogenase
Orthology
K00031  
isocitrate dehydrogenase [EC:1.1.1.42]
Organism
nwa  Nitrosococcus watsonii
Pathway
Citrate cycle (TCA cycle)
Glutathione metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:nwa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Nwat_1248
   01210 2-Oxocarboxylic acid metabolism
    Nwat_1248
   01230 Biosynthesis of amino acids
    Nwat_1248
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Nwat_1248
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Nwat_1248
Enzymes [BR:nwa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     Nwat_1248
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1343203..1344471
Genome map
AA seq 422 aa AA seqDB search
MAYDKISLPSDGQPITVKEDFSLEVPARPLIPFIEGDGIGVDITPVMRQVVDKAIAVAYG
GERSLAWTEVYAGEKATRVYGTDEWLPAETLDALRQFVVSIKGPLTTPVGKGIRSLNVAI
RQVLDLYACIRPVRYFPGTPSPLADPSRTHMVVFRENTEDIYAGIEWPAQSPEAKKIIEF
LRQEMGVEKIRFPESSGIGIKPVSREGSQRLIRKALQYAIDNDRRSVTLVHKGNIMKFTE
GAFCDWGYALAQEAFGARPIDGGPWCEFTPPERGHKIIVKDAIADNFLQQILLRPEEYEV
IATLNLNGDYISDALAAQVGGIGMAPGANMGDRVAVFEATHGTAPKYAGQDRVNPSSIIL
SGEMMLRHLGWNEAADLIIQGITDALAARTVTYDLARLMEGATQVSCSGFGEAIMKHMAA
PA
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atggcttatgacaaaatctcccttccctccgatggccagcctattaccgttaaggaggac
tttagtcttgaagttcccgcccgcccgctcattccttttattgaaggcgatgggattggg
gtggatatcaccccggtgatgcgccaagtcgtcgataaagcaattgccgtggcctatggg
ggggagcgctccctggcctggaccgaggtctatgcgggggaaaaggcaacacgcgtgtac
ggcactgatgaatggctgccagcggagaccttggatgccttgcgacaattcgtggtgtct
atcaaaggcccccttaccacgccagtgggcaaaggtatccgttctttaaacgtggcgatc
cgtcaggtgctggatctctatgcctgcatccggccggttcgatattttccagggacgcca
agtcccttggccgatccttcccgcacccatatggtggtgtttagggaaaacaccgaagat
atctatgccggtatcgagtggccagcccagtcacccgaggcgaaaaaaattattgaattt
ctgcggcaagagatgggcgtggaaaaaatccgttttccggaaagctctggcattggcatt
aagcctgtgtcccgggaaggctcccagcgcctcatccgtaaagctttgcaatacgccatt
gataacgatcgccgttcagtgactctggtgcataagggtaacattatgaagtttactgaa
ggggctttttgtgactggggctatgcgctggctcaggaagcttttggcgcccgccccatt
gatgggggtccttggtgtgagttcacgcctcctgaaagggggcataaaattattgtcaaa
gacgccattgccgacaactttctgcaacaaattctgcttcgtcccgaagagtatgaggtc
attgcgactcttaatctcaatggagattacatctccgatgcgctagcggcccaggtgggc
ggaattgggatggcgccgggggcgaatatgggggatagggttgccgtgttcgaggcgacc
cacgggactgcgcctaaatatgcgggccaggatagggtcaaccccagcagcattattctt
tcgggggagatgatgttgcgccatctcggctggaatgaagcggctgatctgattattcag
ggtattacggatgccttggccgccaggacggtgacctacgacctggcccgattgatggaa
ggcgcgactcaagtctcgtgttctggcttcggggaagccattatgaagcacatggcagct
cctgcttag

DBGET integrated database retrieval system