KEGG   Nitrosococcus watsonii: Nwat_1248Help
Entry
Nwat_1248         CDS       T01266                                 

Definition
isocitrate dehydrogenase
Orthology
K00031  
isocitrate dehydrogenase [EC:1.1.1.42]
Organism
nwa  Nitrosococcus watsonii
Pathway
Citrate cycle (TCA cycle)
Glutathione metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Class
Metabolism; Overview; Carbon metabolism [PATH:nwa01200]
Metabolism; Overview; 2-Oxocarboxylic acid metabolism [PATH:nwa01210]
Metabolism; Overview; Biosynthesis of amino acids [PATH:nwa01230]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:nwa00020]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:nwa00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1343203..1344471
Genome map
AA seq 422 aa AA seqDB search
MAYDKISLPSDGQPITVKEDFSLEVPARPLIPFIEGDGIGVDITPVMRQVVDKAIAVAYG
GERSLAWTEVYAGEKATRVYGTDEWLPAETLDALRQFVVSIKGPLTTPVGKGIRSLNVAI
RQVLDLYACIRPVRYFPGTPSPLADPSRTHMVVFRENTEDIYAGIEWPAQSPEAKKIIEF
LRQEMGVEKIRFPESSGIGIKPVSREGSQRLIRKALQYAIDNDRRSVTLVHKGNIMKFTE
GAFCDWGYALAQEAFGARPIDGGPWCEFTPPERGHKIIVKDAIADNFLQQILLRPEEYEV
IATLNLNGDYISDALAAQVGGIGMAPGANMGDRVAVFEATHGTAPKYAGQDRVNPSSIIL
SGEMMLRHLGWNEAADLIIQGITDALAARTVTYDLARLMEGATQVSCSGFGEAIMKHMAA
PA
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atggcttatgacaaaatctcccttccctccgatggccagcctattaccgttaaggaggac
tttagtcttgaagttcccgcccgcccgctcattccttttattgaaggcgatgggattggg
gtggatatcaccccggtgatgcgccaagtcgtcgataaagcaattgccgtggcctatggg
ggggagcgctccctggcctggaccgaggtctatgcgggggaaaaggcaacacgcgtgtac
ggcactgatgaatggctgccagcggagaccttggatgccttgcgacaattcgtggtgtct
atcaaaggcccccttaccacgccagtgggcaaaggtatccgttctttaaacgtggcgatc
cgtcaggtgctggatctctatgcctgcatccggccggttcgatattttccagggacgcca
agtcccttggccgatccttcccgcacccatatggtggtgtttagggaaaacaccgaagat
atctatgccggtatcgagtggccagcccagtcacccgaggcgaaaaaaattattgaattt
ctgcggcaagagatgggcgtggaaaaaatccgttttccggaaagctctggcattggcatt
aagcctgtgtcccgggaaggctcccagcgcctcatccgtaaagctttgcaatacgccatt
gataacgatcgccgttcagtgactctggtgcataagggtaacattatgaagtttactgaa
ggggctttttgtgactggggctatgcgctggctcaggaagcttttggcgcccgccccatt
gatgggggtccttggtgtgagttcacgcctcctgaaagggggcataaaattattgtcaaa
gacgccattgccgacaactttctgcaacaaattctgcttcgtcccgaagagtatgaggtc
attgcgactcttaatctcaatggagattacatctccgatgcgctagcggcccaggtgggc
ggaattgggatggcgccgggggcgaatatgggggatagggttgccgtgttcgaggcgacc
cacgggactgcgcctaaatatgcgggccaggatagggtcaaccccagcagcattattctt
tcgggggagatgatgttgcgccatctcggctggaatgaagcggctgatctgattattcag
ggtattacggatgccttggccgccaggacggtgacctacgacctggcccgattgatggaa
ggcgcgactcaagtctcgtgttctggcttcggggaagccattatgaagcacatggcagct
cctgcttag

DBGET integrated database retrieval system