KEGG   Nitrosococcus watsonii: Nwat_1303Help
Entry
Nwat_1303         CDS       T01266                                 

Definition
adenine-specific DNA-methyltransferase (EC:2.1.1.72)
Orthology
K03427  
type I restriction enzyme M protein [EC:2.1.1.72]
Organism
nwa  Nitrosococcus watsonii
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1410471..1412183
Genome map
AA seq 570 aa AA seqDB search
MNNPEQQFLKALDDKLWKAADKLRANLDAANYKHVVLGLIFLKYVSDAFEERQEALLERF
KDENDDIYYLPREDFDSDEDYQQALQEELEILDYYREANVFWVPKAARWSTLKEKAVLPV
GTVLWQDDTGHDVKLRSVSWLMDNALEAIEKSNAKLKGILNRISQYQLENDKLLGLINTF
SDTSFTKPMFDGEQLDLHSKDILGHVYEYFLGQFALAEGKQGGQYYTPKSIVTLIVAMLE
PYSGRVYDPAMGSGGFFVSSDKFIEEHAKEHHYDPSEQKKHISVYGQESNPTTWRLAAMN
MAIRGIDFNFGKKNADTFLDDQHPDLRADFVMANPPFNMKDWWSESLADDARWQYGTPPK
GNANFAWMQHMIHHLAPTGSMALLLANGSMSSHTNNEGGIRQRLVEEDLVECMAALPGQL
FTNTQIPACIWFLTRDKANGLVRNEKKRDRREEFLFIDARNLGFMRDRVLRDFTVDDIAK
IADTFHAWQRGEHYEDVAGFCKSASLDEIKKHDFVLTPGRYVGAREQEDDGEPFAEKMAR
LTGQLQEQFVESERLEAEIKRNLGRLGYDL
NT seq 1713 nt NT seq  +upstreamnt  +downstreamnt
atgaacaacccggaacagcaattcctcaaggcgctggacgacaaactctggaaagccgcc
gacaagctccgcgccaacctggacgccgccaattacaagcatgtggtgctgggcctcatc
ttcctcaagtacgtctccgatgccttcgaggaacgtcaggaagccttgctggagcggttc
aaggatgagaacgacgacatctattacttgccccgggaagatttcgacagtgacgaggac
taccaacaagccctgcaggaagagctggaaatactggattactaccgcgaggccaacgtc
ttctgggtgcccaaagctgcccgctggagcaccctgaaggaaaaggccgtactgcccgtg
ggcaccgtattgtggcaggacgatacgggtcacgatgtgaagctgcgctctgtctcctgg
ctgatggacaacgccttggaagccatcgagaagagcaacgccaagctcaagggcattctc
aaccgcatcagccagtaccagttggagaacgacaagctactgggcctgatcaacaccttc
tccgacacctccttcaccaagcccatgttcgacggcgagcagctggacctccacagcaag
gacatcctcggccatgtgtacgaatactttctgggccagttcgccctggctgaaggcaag
cagggtggtcagtattacacccccaaaagtatcgtcaccctgattgtggcaatgctcgaa
ccttactccggccgggtgtacgacccggccatgggctctggcggtttctttgtctccagc
gacaagttcatcgaggaacacgccaaggagcaccactacgaccccagcgagcagaaaaaa
cacatctccgtctacggccaggaatccaaccccactacctggcgcctggccgccatgaac
atggccattcgcggcatcgacttcaacttcggcaagaaaaacgccgacacttttctggac
gaccagcacccggatctgcgggccgatttcgtcatggccaacccgccctttaacatgaag
gattggtggagcgaatccctggcggacgatgcccgctggcaatacggcaccccgcccaag
ggcaacgccaactttgcctggatgcagcacatgattcaccatctggcgcccaccggcagc
atggccctgttgctggccaacggctccatgagttcccacaccaacaacgaaggcggaatc
cgccagcgcctggtggaagaagacctggtggaatgtatggccgccttgcccggccagttg
ttcaccaacacccaaatcccggcctgcatctggtttttgacccgggacaaagccaacggc
ctggtgcgcaatgagaagaagcgcgaccgccgggaagaatttctgttcattgacgcccgt
aacctgggcttcatgcgggatcgagtgttgcgggacttcaccgttgatgacatcgccaaa
atcgccgacaccttccatgcctggcagcgcggcgaacattacgaggatgtcgccggcttc
tgcaaatccgccagcctggacgagatcaagaaacatgattttgtgctgacaccggggcgc
tacgtaggtgcccgagagcaggaagacgatggcgagccctttgccgagaagatggcgcga
ttgaccgggcagctacaggagcagtttgtcgagagtgagcggctggaggctgaaatcaag
cggaatcttgggaggttggggtatgatctctga

DBGET integrated database retrieval system