KEGG   Nitrosococcus watsonii: Nwat_1416Help
Entry
Nwat_1416         CDS       T01266                                 

Definition
arginase/agmatinase/formiminoglutamase
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
nwa  Nitrosococcus watsonii
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:nwa00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Nwat_1416
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Nwat_1416
Enzymes [BR:nwa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     Nwat_1416
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1548602..1549528
Genome map
AA seq 308 aa AA seqDB search
MKIVRIIGAASGWGAPDRRCEAGPEVLRRRGLVAHLRRQGMPVAWEITVRPPENSVSAVA
AVQALSLELSQVTDNVVASGDPFVVLGGDHTCAIGTWSGVVSRWRIAEPVGLIWIDAHMD
AHLPETSPSGALHGMPLACLLGWGDPRLTAIGGPGPTFLPENVVLIGVRSFEPEEHQLLQ
RLGVKVFFMDEVRRRGLSEVFYEALEWVRDRTIAFGVSLDLDAIDPKEAPAVGSPVPGGL
AQEELLPLLRQLHGDFRLMGLEIAEYNPALDERQLTVRLIGELLLSVFAPSRLPYESYHR
AGKAVFSV
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgaagatcgttcgtatcattggtgctgcaagtggttggggcgcacctgatcgtcgctgc
gaagcaggtccggaggttctccgccgtcgaggtttagtagctcatctgcgccggcaagga
atgcccgttgcctgggagatcacggtacggccgccggaaaattcagtaagtgcggtggct
gcggtccaggcactttccctggaactgagtcaggtgaccgataatgtggttgctagtggt
gatccctttgtagttctaggaggcgatcacacttgcgctattgggacctggagcggagtc
gtttcaagatggcgaatcgcggaacccgtggggcttatctggatagatgcccacatggac
gctcatctgccagagaccagccccagtggtgctctgcacggcatgcctctggcctgtctg
ctaggctggggagatcctcggctcaccgccattggaggtcctgggcctacgttcttgcca
gaaaatgtggtgcttattggggtccgcagcttcgagccggaggagcatcaattgcttcaa
cgattaggggtaaaggttttttttatggacgaagtgcgccgtcgtgggttaagtgaagtg
ttttatgaggctttggaatgggtccgggaccggacgatagcatttggagttagtcttgat
ctggatgctattgatcccaaagaggcacctgctgtgggttctccagtgccagggggcctt
gcccaggaagaacttctaccgttgctgcggcagctccatggcgatttccgtttgatggga
ttagaaatcgctgaatataatcctgccttggatgagagacagctaacggttcgtctaatt
ggtgagctgctgctttcggtttttgccccatcgaggttaccctatgaatcctatcatcga
gctggaaaagcagtattcagcgtataa

DBGET integrated database retrieval system