KEGG   Nitrosococcus watsonii: Nwat_1526Help
Entry
Nwat_1526         CDS       T01266                                 

Definition
PAS/PAC sensor-containing diguanylate cyclase
Orthology
K13924  
two-component system, chemotaxis family, CheB/CheR fusion protein [EC:2.1.1.80 3.1.1.61]
Organism
nwa  Nitrosococcus watsonii
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:nwa00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Nwat_1526
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Nwat_1526
Enzymes [BR:nwa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.80  protein-glutamate O-methyltransferase
     Nwat_1526
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Nwat_1526
Two-component system [BR:nwa02022]
 CheA family
  CheA-CheYBV
   Nwat_1526
Bacterial motility proteins [BR:nwa02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Nwat_1526
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1676756..1680457
Genome map
AA seq 1233 aa AA seqDB search
MELKNSGSPPFSIVGIGASAGGVEALQTFFENLPEKPGVAFVVIIHLDPEQRSELAPILA
RKTSMPVEEVQGECALEPNHVYVIAPNQQLQLTDSTVSALPFSQPRGQRAPIDTFFRSLA
QQYGDGFALILSGSGSDGAVGVKAIKEQGGLILVQAPTDARFDGMPRAAIATGVADLVLP
VAQLAQQLPQLIQRKARIYERLEDESHHRQEEESTLRKIFAHLQNKIGHDFSNYKRPTIL
RRLARRMQIQHQPKLTDYLDFLLQTPEESQALFEELLISVTSFFRDPEAWETLREQLLPR
LFEEKAPDAPLRLWVPGCATGEEAYTLAILLLEESERQNLRAEIQVFATDLDAGALATAR
SGYYPAAIEADVSKARLQRYFRAEGNHYRITGEVRDCVLFASHSLLQDPPFSRLDLISCR
NLLIYLDRDLQEQVFGILHYALRPGGYLFLGASESAEGEYFRALDKSHRLFQGRQTLGPT
PPLPYLLTTPSRTWRISTPPSGSPPSTSPAQLHRQLLEELAPPSLLVDERRQVIHLSETV
GRFLQPAGGLPSQDIIALVRPALQAELSTALYRAFEKNKSSLSPFTPVPFNGAPQQVALL
VQPRPATEQQEKTALVIFLEGGEEAQASAPSTDEESPLSLRVHQLQVELRQARAQLRTRQ
EEAEMKSEDLRAANEELQSINEEYRSTAEELETSKEELQSINEELQTVNNELKSKLEEIS
RAHNDLENLMTATEIGTLFLDRHLCIHRFTPPTAKLFSITIHDRGRPITDFTHRLHYHQL
EADAKQVLEDLIPIEHEAQSKEGRWYLVRLRPYRDEHDRIIGVIVTLVDITTRKHTEDEL
RRLNEELASQSAQLQSQDRQKNQFLSLLGHELRNPLAVIYNTTEVLKHNVNTTTPELIAS
KVKLIACQVKHLLRLVDDLLNLTRIHNNRIELKKTTVNVRDIVTSAVDQITVYHHQLALD
FPDSPVYVEADPDRLLQIVANLLNNAVQYTPAGGHIWVTVRQTQEKALIRIRDSGIGFTR
AQLPQLFQPFSRLRIHTGHDGHQSGLGLGLNLARKLAEIHGGSVEGFSAGPGQGSEFTVY
LPALPNEAAAEAAEAAEAAEAAEAAEAAEAATPTTTRRILLVEDDEAVADSLAMLLQIQG
HEVRIIHRGKQTLEAVQSFQPEVVLLDIGLPDRDGYGVARQLRQEPGLENLPLVALTGYG
QSEDIQQAKAAGFNRHLLKPATVETLQKLLGEL
NT seq 3702 nt NT seq  +upstreamnt  +downstreamnt
atggagcttaaaaattcaggttcccctcctttttccattgtgggcattggcgcctccgcc
ggcggggtcgaagccttgcagacattttttgaaaacctaccagaaaagccgggggtcgcc
tttgtagtcatcatccacctggacccggagcagcgcagcgagctagcgcccatcctggcc
cgcaagacctccatgccggtggaggaagtgcagggcgagtgcgcccttgagcccaaccat
gtttacgtcattgctcccaaccagcagctccagctcacggactccacggtaagcgccctt
cccttctcccaaccccggggacagcgagcgcccattgatacctttttccgctcactggcc
caacaatacggcgacggcttcgcccttattctctccggcagcggttccgacggcgctgtc
ggcgtcaaggctatcaaggagcaaggcggcctgatcctggtgcaagcccccaccgatgcc
cgtttcgacggaatgccccgggccgccattgccacgggtgtggccgaccttgtgctgccg
gtagctcaactggcccagcaactgccccagcttattcaacgcaaagcccgaatttacgag
cggctggaggacgagagccaccatcgtcaggaagaagaatccaccctgaggaagatcttc
gcccatctgcaaaacaaaattggccatgacttctctaactacaagcgccccaccatactg
cgccgtctggcccgccggatgcaaatccagcaccaaccgaagctaaccgactacctggat
tttctcctccaaactccggaagagagccaagccctgtttgaggaattgctgatttcggtc
acctccttcttccgcgaccccgaagcctgggaaacattacgcgagcaactccttccccgg
ctgttcgaggaaaaagcgccggacgccccgctccggctctgggtgcccggttgcgccacg
ggcgaagaggcctataccctggccatcctgctgctggaagaaagcgagcggcagaatctg
cgggccgagatacaggttttcgccaccgacctggacgcgggggccttggccaccgcccgc
agcggttattacccggccgcgattgaagccgatgtctctaaagcacgcctgcagcgatac
ttccgggcagaaggcaaccactatcgcattaccggcgaagtccgtgactgtgtccttttc
gccagccacagcctattgcaggacccccccttctcccggctcgaccttatttcctgccgc
aatctgctgatctacctagaccgggatctgcaagagcaggtgtttggcattctgcactat
gccctacgcccgggcgggtaccttttcctcggcgcctccgagagcgccgagggagaatac
ttccgcgccctcgacaaatcccatcgcctcttccagggacgacaaactctaggcccaacc
ccacccctgccctacctgcttaccaccccctcccggacctggagaatatcaacgccgcca
tcagggtcccccccgtcaacgtcacccgcgcagctccaccgccaactgctggaagaactg
gcccctcccagcctgctggtggacgagcggcgccaggtcattcacctctccgagaccgtg
ggccgtttcctccagcccgccggcggcctacccagccaggatatcatcgccctggtacgc
ccggcgctacaagcggaactgagcacggccctctatcgggcctttgaaaaaaacaagtcc
agtctctcgcccttcacgcccgtcccctttaatggcgcgccccagcaggtcgccctcctg
gtgcaaccccgcccagccacggagcagcaggagaaaacagccctggtgatcttcctggaa
gggggcgaggaagcacaagcctcggcacccagcacggatgaagagtcccccttatccctg
cgggtgcaccaactgcaagtggaactacgccaggcccgcgcccaattgcgcacccggcag
gaagaagcggaaatgaaaagcgaggatctgcgggccgccaacgaagagctccaaagcatt
aatgaggaataccgctccaccgcagaggaactggaaaccagtaaggaagagctccagagt
attaacgaggaactccaaacggtgaacaatgagcttaaaagtaagctggaagaaatctcc
cgcgctcataacgatctggaaaacctcatgaccgccaccgagattggcaccctgtttctc
gaccgccacctgtgcatccaccgcttcacgccgcccacggccaagctcttttccattacc
atccatgatcgcgggcggcccatcaccgatttcacccatcgccttcattaccaccagctt
gaagccgacgccaagcaagtgctggaggatctgatacccatcgagcatgaagcccaaagc
aaggaagggcggtggtatctggtacgccttcgcccctaccgcgatgaacacgatcggatt
attggcgtcatcgtcaccttggtggatatcacaacccgcaagcacaccgaggatgagcta
cgccggctcaatgaggaactggcgtcgcagtcggcccaattacaatcccaagaccgccaa
aagaaccaatttctcagtctgctcggccatgaactgcgcaaccccttggcggttatttac
aatactaccgaggtgctcaagcataacgtcaacacgaccacgccggagctgatcgcctcc
aaggttaagctcattgcctgccaggtgaaacatctgctacgcttggtggacgacctgtta
aatctgacccgcatccataacaaccggatcgagctgaagaaaaccaccgtgaatgtgcgg
gatatagtcactagcgccgttgaccagatcaccgtctatcaccatcaactggcattggat
ttccccgactcccccgtctacgtggaagcggacccggatcggctgcttcagatcgtggcc
aacctactgaacaacgctgtccagtacacgcccgctgggggccacatctgggttaccgtg
cggcagacccaggagaaagcccttatccggatacgggatagcgggataggcttcacccgc
gcgcagttgccgcaactgttccagcccttcagccggctgcgaatccacaccggccacgat
ggccaccagagcggcttgggcctgggcctgaacctggcccgcaagctggcggaaattcat
ggcggcagcgtggaaggtttcagcgccggcccgggtcaaggcagcgaattcacggtgtac
ctacccgccctgcccaatgaagcggccgcagaagccgcagaagccgcagaagccgcagaa
gccgcagaagccgcagaagccgcagaagccgccaccccgacgacaacccgccgcatcctg
ctggtggaggacgatgaagccgtggccgattccttggcaatgctgctccagatccaaggc
catgaggtgcgcatcattcatcggggcaagcaaacgctagaggcggtccagtcgttccag
ccggaggtggtgctcctggatatcggcctgccggatagggatggctacggggttgcccga
cagctgcgccaggagccgggcctggaaaacctccccctggtagccctcaccggctacggc
caaagcgaggatatccaacaagctaaggcggccggcttcaatcgccatctcctcaaaccg
gccaccgtcgagaccttgcaaaaactcctgggggaactttga

DBGET integrated database retrieval system