KEGG   Nitrosococcus watsonii: Nwat_1686Help
Entry
Nwat_1686         CDS       T01266                                 

Definition
(RefSeq) phosphoglycerate mutase (EC:5.4.2.4)
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
nwa  Nitrosococcus watsonii
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:nwa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Nwat_1686
   01230 Biosynthesis of amino acids
    Nwat_1686
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Nwat_1686
  Energy metabolism
   00680 Methane metabolism
    Nwat_1686
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Nwat_1686
Enzymes [BR:nwa01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Nwat_1686
Exosome [BR:nwa04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Nwat_1686
  Exosomal proteins of melanoma cells
   Nwat_1686
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1842321..1843052)
Genome map
AA seq 243 aa AA seqDB search
MNRVILLRHGESMWNLENRFTGWTDVDLSTNGVEEARLAGKILKNEGYQFDKAYTSVLKR
AIRTLWIVEEMMDLVWLPVEKRWELNERHYGSLQGLNKAEMAKQYGAELVHQWRRGYGIE
PPPLDNSDPRHPRFDRRYAGLAPEALPASESLKKTLQRVIPCWKQCILPDIAAGKELIIV
AHGNSLRALYKHLEGLSDQEVMELNIPTGIPLVFELDSAFRPTAHYYLADSEKSQEAIGD
TAH
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
gtgaatagagtgatattacttcgtcatggtgaaagcatgtggaatttggagaatcgcttc
accggttggacggatgtcgatctttctacaaatggcgttgaagaagcccgtcttgcgggt
aagattttgaaaaatgaagggtatcaattcgataaggcctatacgtcggtacttaagcgg
gctattcgcactctttggatcgtagaagaaatgatggacctggtatggctccctgtggag
aaacggtgggaactgaatgagcgccattatggcagtctgcaagggttgaacaaagcagaa
atggctaagcaatatggtgcggagttagtgcatcagtggcgtcggggttatgggattgag
ccaccgccattggataattccgatccccggcatccgcgcttcgataggcgttatgcaggc
ttggctccggaagcgctgccagcatcagaatctcttaaaaagacccttcagcgggttatt
ccctgctggaaacagtgcatcttgccggatattgccgctggtaaggagctaattattgtt
gctcacggtaattctttgcgggctttatataaacatcttgagggactatctgatcaagaa
gtgatggagcttaatattcctacgggtattcccttggtgttcgagctagacagcgccttc
agaccaaccgcccattattatctggctgactctgaaaagagccaggaagcgattggtgac
accgcccattag

DBGET integrated database retrieval system