KEGG   Nitrosococcus watsonii: Nwat_2010Help
Entry
Nwat_2010         CDS       T01266                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
nwa  Nitrosococcus watsonii
Pathway
nwa00260  Glycine, serine and threonine metabolism
nwa00400  Phenylalanine, tyrosine and tryptophan biosynthesis
nwa01100  Metabolic pathways
nwa01110  Biosynthesis of secondary metabolites
nwa01130  Biosynthesis of antibiotics
nwa01230  Biosynthesis of amino acids
Module
nwa_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:nwa00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Nwat_2010
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Nwat_2010
Enzymes [BR:nwa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Nwat_2010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth PcrB
Motif
Other DBs
NCBI-ProteinID: ADJ28844
JGI: Nwat_2010
UniProt: D8K7G7
Position
complement(2197068..2197883)
Genome map
AA seq 271 aa AA seqDB search
MSRITERFALLREQGRKALIPYITAGDPKPQVTVPLMHALVAAGADILELGVPFSDPMAD
GPVIQKACERALAEGTSLLDVLAMVAEFRRDDQETPVILMGYLNPIEILGYQNFAQQAAV
HGVDGLLTVDMPPEEAAPLVVACEEQGLDRIFLLAPTSSPKRIEQICALGSGFIYYVSLK
GVTGASTLDVDDVSLHVANIRRHTSMPVGVGFGIRDAPSAAQIASIADAVVVGSALVKRI
EQYQDSPEAIPEEVSALLRTMREAIDAAKNI
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
gtgagccggattaccgagcgttttgccctccttcgggagcaaggacgaaaagccctgatc
ccgtatattacggcgggtgatcccaagccccaggtgacggttcctttaatgcatgccctg
gtggcggcaggcgctgatatcctggaactgggagttcctttttccgacccgatggccgat
ggtcccgttattcagaaggcttgcgagcgggcactggctgaaggtacttccttattggat
gttttggcgatggtggctgagtttcgccgcgatgatcaggaaaccccggtaattttgatg
ggttaccttaatcccattgaaatactaggctatcaaaattttgcccagcaagcagctgtt
catggagtcgatggccttctgacagtggatatgccacccgaggaagcagcgccattagtg
gtggcttgcgaggaacaagggcttgatcggatttttttgctggcacccacgagctccccg
aagcgtatagagcaaatttgcgccttgggcagtggatttatttactatgtttctttaaaa
ggcgtgactggcgcctctaccctggatgtggatgacgtaagcctgcatgtagctaatatc
cggcgtcatacctccatgccggtgggggtgggattcggcattcgagacgcgccctcggcc
gctcagattgcgtccattgccgatgcggtggtcgtggggagcgctttagtcaaacgcatt
gagcaataccaggatagcccggaggcgataccggaggaagtcagtgctttactgcgaaca
atgcgcgaagctattgatgccgctaaaaatatttaa

DBGET integrated database retrieval system