KEGG   Nitrosococcus watsonii: Nwat_2011Help
Entry
Nwat_2011         CDS       T01266                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
nwa  Nitrosococcus watsonii
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:nwa00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Nwat_2011
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Nwat_2011
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Nwat_2011
Enzymes [BR:nwa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Nwat_2011
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(2197880..2199112)
Genome map
AA seq 410 aa AA seqDB search
MSTEAQALAAGRNDDQMPDEKGHFGPYGGRFIAETLMEPIEELRQAYERYRDDPDFQAEL
ESDLAHYVGRPTPLYFAQRWSEQLGGARIFLKREDLSHTGAHKINNTVGQALLAKRMGKT
RLIAETGAGQHGVATATVAARLGLECVVYMGSEDIERQAPNVYRMRLLGAEVVPVTSGSR
TLKDALNEAMRDWVAHVDNTFYVIGTVAGPHPYPVMVRDFQAVIGREARTQILAQLGALP
HALVACVGGGSNAIGLFHPFCKDEQVALYGVEAAGLGLETGQHAASLCAGKPGVLHGNRT
YLVENSHGQIMDTHSISAGLDYPGVGPEHAWLKDTGRATYVAISDEEALAAFHALTRIEG
IIPALESSHALAYAMHLAPTLAPEQGIIVNLSGRGDKDINTVAKIEGISL
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
gtgtcaactgaagcccaggctttagcagccggcaggaacgacgatcagatgcctgacgaa
aagggtcattttggtccttatggtggccgttttatagcggaaaccctgatggagcctatc
gaggaactccgccaggcctatgaacgctatcgtgatgatccggatttccaggctgagcta
gaatccgatcttgcccattatgtggggcggccgacgcccctgtattttgcccaacgctgg
agcgagcagttagggggcgcccggatctttttgaagcgggaagatcttagccataccggc
gcccataaaatcaacaataccgtggggcaggccctgctggcaaaacggatggggaagacc
cgtttgatcgccgaaacgggcgcgggtcagcatggcgttgctacggctacggtagccgcc
cgcttaggcctggagtgcgtggtctacatggggtccgaggacatagagcggcaagcccct
aatgtttaccggatgcgcctgttaggggcagaagtagtgcctgtgacttccgggtcgaga
accttgaaggatgccttgaatgaagccatgcgagattgggtggctcatgtggataatacc
ttttatgtgattggcaccgtggcggggcctcatccctatccggtgatggtgcgggatttc
caggcggtgattgggcgggaggcccggacccagattctggcgcagctaggcgcgcttccc
catgctttggtggcttgcgtggggggcggttccaatgccattggcttgttccatcctttt
tgcaaggatgagcaagtcgcgctctatggtgtggaagcggcggggttaggactggaaacc
gggcagcatgctgcttccctctgcgcgggcaagccgggcgttcttcatggcaaccggacc
tacctggtggaaaatagccatggccagattatggatacccattccatttcggcgggtctt
gattatcctggggtaggtcctgagcacgcttggttgaaggatactgggcgggcgacctat
gtggccattagcgatgaggaggccctggcggcctttcatgccctgacccgcattgaaggt
attattcccgctttggaaagcagtcatgccttggcctacgctatgcacttggcgcccact
ttggcgccggagcaagggattatcgtcaatctctcggggcgtggggataaagacatcaac
acagtagccaaaattgaggggatttccctgtga

DBGET integrated database retrieval system