KEGG   Nitrosococcus watsonii: Nwat_2036Help
Entry
Nwat_2036         CDS       T01266                                 

Definition
hopanoid-associated sugar epimerase
Orthology
K00091  
dihydroflavonol-4-reductase [EC:1.1.1.219]
Organism
nwa  Nitrosococcus watsonii
Brite
Enzymes [BR:nwa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.219  dihydrokaempferol 4-reductase
     Nwat_2036
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2223439..2224428
Genome map
AA seq 329 aa AA seqDB search
MTSFVTGATGFVGSAVVKQLLDAGETVRVLARSNSDRRNLEGLPIEIFEGDLKDQRRLEK
ALHGCQALFHVAADYRLWAPRSQDFYDTNVRGSENIIHAAAEAGVNRIVYTSSVATLGLS
PDGTPTDEETPSSLDTMIGHYKRSKFLAEESVKDLRRRLGLNIVIVNPSTPIGPRDIKPT
PTGRVIVMAASGNMPAYMNTGLNVVHVDDVAAGHLLAFEKGGMGERYILGGENLTLHDIL
ATIAQLTHRRPPRFRLLPHMVLPIAYLAQGWARLTNGKEPMTTVDGVRMAKKYMFFSSTK
AEQLLGYQSRPAQEAIHDAISWFQANNYL
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgaccagctttgttaccggcgcaaccggctttgtaggttcggcggtagtcaagcaactg
ctcgatgcgggagaaactgtccgggtattagcccgctccaacagtgatcggcgtaatttg
gaagggttacccatagaaatctttgaaggtgatcttaaagatcaacggcgcctagaaaaa
gcgctccatggttgccaagctctttttcatgtggcggctgattaccgcttatgggctccc
cgttcgcaagacttttatgatactaacgtccggggctccgagaatatcatccacgctgcg
gcggaagccggcgttaaccgtattgtttacaccagtagcgtcgccacgctgggattaagc
cctgatggtacgccaactgatgaggaaaccccctccagcctcgacaccatgatcggccac
tataaacgatctaaatttttggctgaggaatcagttaaggatctgaggcgcagactgggg
ctaaatatcgtgattgttaacccctccacccctattggaccacgggatatcaaacccacg
cctactggcagagtcattgtcatggccgcctcaggaaacatgcctgcctacatgaacacc
ggtctcaacgtggtccatgtggatgatgtcgccgctggccacctcctggcctttgaaaaa
ggcggcatgggtgagcgttatattcttggaggcgagaaccttaccctgcatgatattctg
gcaacgatcgcccagcttacccaccgccgtcctcctagattccgacttttacctcacatg
gtcttgccaatcgcttaccttgctcaaggctgggctcgtctgaccaacggcaaagaaccc
atgaccacggttgacggcgtgcggatggcaaagaaatatatgtttttttctagcactaaa
gcggagcaactgctaggctatcagtctcgccccgctcaagaagcaattcatgatgcaatt
agctggtttcaggccaataactacctgtag

DBGET integrated database retrieval system