KEGG   Nitrosococcus watsonii: Nwat_2040Help
Entry
Nwat_2040         CDS       T01266                                 

Definition
helicase, RecD/TraA family (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
nwa  Nitrosococcus watsonii
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:nwa00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Nwat_2040
Enzymes [BR:nwa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Nwat_2040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2227575..2229758
Genome map
AA seq 727 aa AA seqDB search
MNTFHPESLPEYLTGTIERVTFHSEESGFCVLRVKVRGERDLITVVGNTATAIPGEYVEC
RGEWLNDRTHGLQFKAKHLKVIPPSTLEGIEKYLGSGMVKGIGPHFAKKLVQTFGEQVFE
IIEHKAERLTELDGIGPKRKARVIQSWAEQKAVRAIMVFLQSQGVGSARAVRIYKTYGDH
AIEQVRENPYRLALDIHGIGFKTADRIAQRLGIPADSLIRAQAGVRHVLQEFATEGHCAM
EREKLADTASQLLEISVPIIEHAIAQEVTEGQFIDEIIHDKPCLFLASLYRAETGIAKHL
QRLLQSLPPWGEINTDKAIPWVEEKTGLRFSPSQRAAVIQAVRGKITVISGGPGVGKTTV
VNSILRIIRAKQIQVHLGAPTGRAAKRLAESTGLEAKTIHRLLEFDPHAMGFKHHGGNPL
HTDFIVIDEVSMVDVKLMNQLLQAIPTHAACLLIGDRDQLPSVGPGQVLADIIASKKITT
AHLTEVFRQAANSKIVVNAHRINQGKMPERTHEAAPLSDFYFIPTESPEAIQDRLLELVT
TRIPKRFGFDPICDIQVLTPMNRGSLGTQALNALLQQQFNPQAGPKINRFGWTFAPGDKI
VQTVNNYDKEVFNGDIGRITRIDPEKSLVYISIDDREVEYELGELDEIALAYAISVHKSQ
GSEYPAVVIPLATQHYTMLQKNLLYTGVTRGKKLVVIVGQPKALAIAVKKSHATSRLTHL
SARLANS
NT seq 2184 nt NT seq  +upstreamnt  +downstreamnt
atgaacactttccacccagaatctctgcctgaatatctcactggcaccatagaacgggtt
acttttcatagcgaggaaagtggattttgcgtcctgcgagtcaaggtgcgtggcgagcgc
gatctcatcaccgtggttggtaataccgcgacagccataccgggggaatatgtggaatgt
cgcggcgaatggctcaatgaccgcacccatggacttcagttcaaagcaaaacatctgaaa
gtcatcccccccagcactctcgaaggaattgaaaagtatctcggctcgggcatggtcaaa
gggatcggtccccactttgccaagaaattggtacaaaccttcggcgaacaagtgttcgag
attattgaacacaaagccgagcgcctcaccgaattagacggcatcggccccaagcgcaaa
gcgcgagtcattcaatcctgggcggaacaaaaagctgttcgcgccattatggtattttta
caatcccagggcgtgggtagcgccagggcggttcgcatttataagacctacggcgatcac
gccatcgaacaggttcgcgagaatccttaccggctggcgttagacattcatggtattggt
tttaaaaccgccgacaggattgcccaacggctaggaattcccgctgattcccttatccgc
gcccaagcgggagtccgccatgtactccaggaattcgcaaccgaaggacattgcgcgatg
gagcgggaaaaattagcggacacagctagtcaattgctggaaatttccgtccctattatc
gaacatgccattgcccaagaagttactgaaggacaattcatcgacgagattattcatgac
aaaccctgcctatttcttgcctctctttatcgtgcggaaacaggcatcgccaaacattta
cagcgcctccttcagagtctccccccttggggagagatcaatacggataaggctattccc
tgggtggaagagaaaacaggattgcgcttctccccctcgcaacgtgcggcggttatacaa
gcggtcaggggcaaaatcactgttattagcgggggtccgggggttggaaaaaccactgtc
gttaatagcattctccgcattattcgagccaagcaaatccaggtccaccttggagcgcct
accgggcgagcggcaaaacggcttgctgagtccactggacttgaagccaaaacgattcac
cgtctgcttgaattcgatccccatgccatgggtttcaagcatcatggaggcaaccccctc
cacactgattttatcgttattgatgaagtttccatggtcgatgtgaaattgatgaatcaa
ctacttcaagccatccccacgcatgcggcatgcctgctaataggcgatagagaccagttg
ccttcggtagggccagggcaggtattagcggatatcatcgcttccaaaaaaattacgacc
gcccatctcaccgaagtttttcgccaggcggccaactctaaaatcgttgtcaatgcccac
cgaatcaatcaaggaaagatgcctgagagaacccatgaagcggccccgctcagtgacttc
tattttattcccactgagtcacctgaagccatccaggataggctcctagaattagtcacc
acgcggatacccaaacgcttcggctttgaccccatttgtgatattcaagtcctgaccccc
atgaatcggggcagtcttggaacacaagcgcttaatgcacttctgcaacagcaattcaat
ccccaagccggccccaaaatcaaccggttcggctggacctttgccccaggcgacaagatt
gttcagactgtcaataattatgacaaagaagtcttcaatggagatattggcagaataacc
cggatagatcctgagaagagcctcgtgtatatcagcatcgatgaccgcgaggtagaatac
gaactaggtgaacttgacgaaattgctttagcctacgctatctcggtgcataaaagccaa
ggttcagaatacccagcggttgtcattcccctagctacccagcactataccatgctacag
aagaatctcctctacacgggtgttacccgcggcaaaaagctggtcgttattgtggggcag
cctaaagcgcttgccatagccgttaaaaagtcccatgcaacctctcgcctgacccatctt
tcagcacggttagcgaacagttga

DBGET integrated database retrieval system