KEGG   Nitrosococcus watsonii: Nwat_2085Help
Entry
Nwat_2085         CDS       T01266                                 

Definition
disulfide bond isomerase, dsbC/G-like protein
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
nwa  Nitrosococcus watsonii
Brite
Enzymes [BR:nwa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     Nwat_2085
Secretion system [BR:nwa02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   Nwat_2085
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2284200..2284937)
Genome map
AA seq 245 aa AA seqDB search
MGKKLLGFLLAGGLVTLSFTALGNEEIEAVRASLQKLVPGTEPQSIKPAPIPGIYEVVLE
GQVFYLSQDGRYMVQGQLVDLATRTNLTEERLKVIRAAAISNLDEQDMIVFGPEQAKHTV
NVFTDIDCGYCRQLHQHIKEYNALGLKIRYLAFPRAGIGSSSYDKAVEVWCAKDPHQAMT
QAKAGKPVENTAKCENPVADQFKLGQSLGVNATPTLMLEDGTVLPGLVRPQALVNILEQK
VAAHP
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgggaaagaaattactaggttttttattggcgggggggttggttacgctctcatttacc
gcgcttgggaacgaggaaattgaagcggtgcgggcatctctgcaaaaattggtgccgggg
acggagcctcagagcatcaagccggcgcctattcctggcatttatgaggtagtgttggag
gggcaagtattttatctaagtcaggatggccgttatatggtgcaaggacagttggttgat
ttggcaacccggactaatttgaccgaggagcggctcaaggttatacgggctgcggccatc
agcaatctagatgaacaggatatgattgtgtttggacccgagcaggcaaaacacacggtg
aatgtctttacggatattgattgcggttactgccgccaattacatcagcatataaaagag
tataatgctttggggcttaagatccgctatcttgcttttccccgtgccggtattggctct
tcttcctatgacaaggcggtagaggtatggtgcgctaaggacccccatcaggcaatgact
caagccaaggcgggaaagccagtggagaacactgctaaatgcgagaatcccgtggctgat
cagtttaaactcggtcaatctttgggggttaatgccacgccaactctgatgctggaagat
ggtacggtgttgccagggctcgttcgtcctcaggcactcgttaatatcctggaacagaag
gtggcggctcatccctga

DBGET integrated database retrieval system