KEGG   Nitrosococcus watsonii: Nwat_2284Help
Entry
Nwat_2284         CDS       T01266                                 

Definition
3-hydroxyacyl-CoA dehydrogenase NAD-binding protein
Orthology
K01782  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
nwa  Nitrosococcus watsonii
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:nwa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Nwat_2284
   01212 Fatty acid metabolism
    Nwat_2284
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Nwat_2284
   00650 Butanoate metabolism
    Nwat_2284
  Lipid metabolism
   00071 Fatty acid degradation
    Nwat_2284
   01040 Biosynthesis of unsaturated fatty acids
    Nwat_2284
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Nwat_2284
   00310 Lysine degradation
    Nwat_2284
   00380 Tryptophan metabolism
    Nwat_2284
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Nwat_2284
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Nwat_2284
   00281 Geraniol degradation
    Nwat_2284
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    Nwat_2284
Enzymes [BR:nwa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     Nwat_2284
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Nwat_2284
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     Nwat_2284
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2485527..2487545
Genome map
AA seq 672 aa AA seqDB search
MNNNNDWYTEKDTDGIVWLRLNQSGTKTNVLSKSVLEALDRHLVQLATENPKGLVILSDK
KQGFIAGADVTEFTALRKATEARAWIQRVHEIFNRLANLPFPTVAVIHGYCLGGGLELAL
ACRYRVAANNPETQLGLPEVKLGIHPGYGGTVRLPRLIGTLPALEMMLKGRSLNTRAAAR
LGLIDQAVPSRHLQRAARAFIEKSPPPHCPPFWQRLIGQPPMRRLVTKILRSRLEKRVNS
RHYPAPFALLELWEKQEGTTEQRLALEAESLTALLISETTNNLIRVFLLQQRLKSLGKQG
IFKPERVHVIGAGTMGGDIATWCALKNLRVSLQDRSPEHIAPAIKRAHGLFKKRLKDQRP
IQAAMDRLMPDPRGEGLAKADVLIEAIFENIEAKQALFQAIEPRLKAETLLATNTSSIPL
ETLAESLSQPERLVGLHFFNPVAKMQLVEVVKGEATTAGEMEQAAAFTRQIGRLPLPVKS
LPGFLVNRVLTPYLLEATRLLSEGVPGPVIDQAAIDFGMPMGPIELADTVGLDICLSVAE
RLTPSEQIPEELKLKIQQGQLGKKSGNGFYRYQRGKPVKPQPPQEYQAPGDLTDRLILSM
INEAVSSLHDRVVEDADLLDAGMIFGIGFAPFRGGPLHYVRTQGVKTMRQRLQALEAQYG
TRFTPSAGWQAL
NT seq 2019 nt NT seq  +upstreamnt  +downstreamnt
atgaataacaataatgattggtacacggaaaaagataccgatggcattgtctggctacgc
cttaatcaaagtggaacaaagactaacgtattgtccaaatccgtactagaagcactagat
aggcacttagtccaattagctacggaaaatcctaagggcctcgtcatcctttccgataag
aagcaaggctttattgccggagcggatgtcaccgaatttaccgcgcttcgtaaggcaacc
gaagctcgagcatggattcagcgggtccatgaaatctttaatcgcttggccaatcttcct
tttcccaccgttgctgttatccatggctattgcctcggtggcgggctagagctagccctt
gcttgtcgctaccgggtagcagccaataatcctgagactcaactcgggctgcctgaagtc
aagcttggaatccatcccggttatggcggcaccgtacgcctaccacgactcatcggtacc
cttcccgcccttgagatgatgctgaaggggcgcagcctcaatactcgtgccgcagcacgt
ctgggactgattgatcaagccgtcccctctcgccaccttcagcgggccgcccgtgccttt
atagaaaaatcgccccctccccactgtccccctttctggcaacgtctgataggtcagccg
ccaatgcggcgactcgtcaccaaaatattacgctcccgacttgaaaaacgagtcaactca
aggcactatcccgcccctttcgctttattggagctatgggaaaagcaagaaggcaccacc
gagcagcgcctggcgctcgaggccgaatcccttaccgcccttctcatcagcgaaacaact
aacaacctcattcgggttttcctgctccaacaacggcttaaatccctggggaaacaaggt
atctttaagcctgaacgggtccatgtgataggggctggcaccatggggggtgatattgcc
acctggtgcgccttaaaaaaccttcgtgttagcctccaggatcgatcccccgagcatatt
gctccagccattaagcgagcccatggattattcaagaaacgtctcaaagaccagcgtcca
atccaagccgccatggatcggctaatgcccgatccgagaggagagggactcgctaaagcc
gatgtattgattgaagctatcttcgagaatatagaagccaaacaagccttatttcaggct
atcgaacctaggctaaaagcggagaccttactggccaccaatacttccagtattccctta
gaaactttggctgaaagcttgtctcaaccagaacggttggtaggacttcatttctttaat
cccgttgccaaaatgcagttggtcgaagtagtaaaaggagaggcaacgacagccggagag
atggagcaagccgcagcttttacccgccagatcggccgtctccccttgccggtaaaaagc
ctgccaggatttttggttaatcgtgtacttaccccctacctcctagaagccacgcggtta
ctcagcgaaggcgttcccggcccagtcatcgatcaagctgctatcgattttggcatgccc
atgggccccatcgaactagcagatacggtgggccttgatatctgcctctcagtggccgaa
agattaaccccctctgagcaaatacccgaagagctgaaactcaaaattcaacaaggtcag
cttggcaaaaaaagcgggaacggattttacagataccaaagaggaaaaccggtaaagccc
caacctccgcaggaataccaagctcctggagatcttaccgaccgcttaattctctctatg
atcaacgaagccgtctcctccctccatgaccgggttgtggaagatgccgatttgctcgac
gccggtatgatctttggcattggttttgccccttttcggggaggccccctccactatgtg
cgcactcaaggagtgaagacaatgcggcaacggctgcaggcgttggaagcccaatatgga
acccggtttacccccagcgcaggatggcaggcattataa

DBGET integrated database retrieval system