KEGG   Nitrosococcus watsonii: Nwat_2296Help
Entry
Nwat_2296         CDS       T01266                                 

Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
nwa  Nitrosococcus watsonii
Pathway
nwa00900  Terpenoid backbone biosynthesis
nwa01100  Metabolic pathways
nwa01110  Biosynthesis of secondary metabolites
nwa01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:nwa00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Nwat_2296
Enzymes [BR:nwa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     Nwat_2296
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXPR_C DXP_redisom_C
Motif
Other DBs
NCBI-ProteinID: ADJ29124
JGI: Nwat_2296
UniProt: D8K8K4
Position
complement(2500065..2501246)
Genome map
AA seq 393 aa AA seqDB search
MIGVSILGSTGSIGMSTLDVLARYPTRYRVQALSANKSVARIYQQCLQFRPSQVVMVDPD
AAEQLRQRLRPVVPEIEVSGGSQALEAIVTSPDTDYVMAAIVGAAGLLPTLAAARAGKRI
LLANKEALVMSGQLFMSAVSESGAELLPIDSEHNALWQCMPVKGRELPLHRKGVRRILLT
ASGGPFRERALSELDNVTPDEACAHPNWDMGRKISVDSATMMNKGLEVIEACWLFDAAAR
QIEVVLHPQSVIHSMVDYVDGSVLAQLGNPDMRIPIAYGLAWPERMESGVALLDLFAVGQ
LTFCQPDLQRFPCLELAYAALEQGGTCSTILNAANEVAVQAFLDQRIRFTQIPNLIEWTL
GSVTPTVADSLSAVLESDAVARQVAKEQIERWY
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgataggggtcagcatactggggtcaacgggctccattggtatgagcacccttgatgtg
ctggcgcgctacccaacacgctaccgggttcaagccttatccgcaaacaaatccgtagca
cggatttaccagcagtgcctccaattccgaccttcccaggttgtgatggttgatcctgat
gcagctgaacagctacgtcagcggttgcgccccgttgtgccggagatagaagtcagtggc
ggcagccaagccttggaggctatcgtcacatctcctgataccgattatgtcatggcggcc
attgtaggtgctgctggtttattacctaccttggccgcagcgcgagcaggcaagcggatt
ttgcttgccaataaagaggcgcttgtgatgagcggtcagctatttatgagtgctgttagt
gaaagcggcgcggagttgctccccattgacagcgagcataatgccctttggcaatgtatg
ccagtgaagggccgcgaactccccctgcaccgcaaaggtgtgcggcgtattttactgacc
gcctcgggcggaccctttagagagcgggcgctgtccgagttggataatgttactcccgat
gaggcgtgcgcgcatcctaactgggatatgggacgtaagatatcagttgattcggctacc
atgatgaacaaggggctagaagttattgaagcctgctggctatttgacgctgcggcccgc
cagattgaagtcgttttgcatcctcagagtgttattcactccatggtggattatgtggac
ggttctgtcttggcacagttgggtaatcctgatatgcggatacctattgcttatggattg
gcttggcccgagcgtatggaatcgggggtggctcttttggatctgtttgcggtaggccag
ttgactttctgtcagcccgatttgcaacgcttcccttgcctggaactagcctatgctgcg
ctggagcagggaggcacctgtagtactattttgaatgcagctaatgaagtggcggtccag
gcgtttctcgatcagcgtatccggtttacccagattccaaaccttatcgaatggacgtta
ggtagcgtgactcccactgtggctgattctctttcggccgtgctagaaagtgacgcagta
gcgcggcaagtagctaaagaacaaatagagcggtggtattaa

DBGET integrated database retrieval system